Recombinant Human Signal Transducer and Activator of Transcription 3, STAT3 (C-6His)

Contact us
Catalog number: CF29
Price: 804 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Signal Transducer and Activator of Transcription 3, STAT3 (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2486€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human STAT3 is produced by our E, coli expression system and the target gene encoding Met1-Asn175 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 8 kD
UniProt number: P40763
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: STAT3 (C-6His), Signal Transducer Activator of Transcription 3
Short name: STAT3 (C-6His), Recombinant Signal Transducer Activator of Transcription 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Signal Transducer and Activator on Transcription 3, signal transducer and activator on transcription 3 (acute-phase response factor) (C-6His), recombinant H
Alternative technique: rec
Alternative to gene target: ADMIO and APRF and HIES, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006606 and protein import into nucleus and biological process this GO :0006928 and cellular component movement and biological process this GO :0006953 and acute-phase response and biological process this GO :0007165 and signal transduction and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007399 and nervous system development and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0010033 and response to organic substance and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016032 and viral process and biological process this GO :0016310 and phosphorylation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0019903 and protein phosphatase binding and molecular function this GO :0019953 and sexual reproduction and biological process this GO :0030522 and intracellular receptor signaling pathway and biological process this GO :0031730 and CCR5 chemokine receptor binding and molecular function this GO :0032355 and response to estradiol and biological process this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0034097 and response to cytokine and biological process this GO :0035259 and glucocorticoid receptor binding and molecular function this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0042493 and response to drug and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0042755 and eating behavior and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045747 and positive regulation of Notch signaling pathway and biological process this GO :0045820 and negative regulation of glycolytic process and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048708 and astrocyte differentiation and biological process this GO :0060019 and radial glial cell differentiation and biological process this GO :0060396 and growth hormone receptor signaling pathway and biological process this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0070102 and interleukin-6-mediated signaling pathway and biological process this GO :2001223 and negative regulation of neuron migration and biological process, STAT3 and IDBG-50702 and ENSG00000168610 and 6774, STAT3 and IDBG-640197 and ENSBTAG00000021523 and 101910056, Stat3 and IDBG-211637 and ENSMUSG00000004040 and 20848, nuclei, protein dimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0001103 and RNA polymerase II repressing transcription factor binding and molecular function this GO :0001659 and temperature homeostasis and biological process this GO :0001754 and eye photoreceptor cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0004879 and ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006351 and transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0001103 : RNA polymerase II repressing transcription factor binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0004871 : signal transducer activity and also this GO :0004879 : ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0019901 : protein kinase binding and also this GO :0019903 : protein phosphatase binding and also this GO :0031730 : CCR5 chemokine receptor binding and also this GO :0035259 : glucocorticoid receptor binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0046983 : protein dimerization activity, this GO :0001103 : RNA polymerase II repressing transcription factor binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0004871 : signal transducer activity, this GO :0004879 : ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0019901 : protein kinase binding, this GO :0019903 : protein phosphatase binding, this GO :0031730 : CCR5 chemokine receptor binding, this GO :0035259 : glucocorticoid receptor binding, this GO :0043565 : sequence-specific DNA binding, this GO :0044212 : transcription regulatory region DNA binding, this GO :0046983 : protein dimerization activity, 508541, signal transducer and activator of transcription 3 (acute-phase response factor)
Identity: 11364
Gene: STAT3 | More about : STAT3
Long gene name: signal transducer and activator of transcription 3
Synonyms gene name: signal transducer and activator of transcription 3 (acute-phase response factor)
Synonyms: APRF
Locus: 17q21, 2
Discovery year: 1995-11-08
GenBank acession: BC014482
Entrez gene record: 6774
Pubmed identfication: 7512451
RefSeq identity: NM_139276 NM_003150
Classification: SH2 domain containing
Havana BLAST/BLAT: OTTHUMG00000150645
Locus Specific Databases: STAT3base: Mutation registry for Hyper-IgE syndrome LRG_112

Related Products :

CF29 Recombinant Human Signal Transducer and Activator of Transcription 3, STAT3 (C-6His) 1 mg 2486 € novo human
DL-STAT3-Hu Human Signal Transducer And Activator Of Transcription 3 STAT3 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc28e5ef8e Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc28eb862e Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc50b3adac Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc76472077 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc991d06ea Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc9923dbf0 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcb64bd6b0 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcb65285de Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdccc7d7617 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdccc840443 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdd0f719211 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd2c6c72b2 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd3da5897c Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd4f7d95b9 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd60f0912d Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 625 € MBS Polyclonals human
GENTAUR-58bdd6a5c2af7 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd777ec98a Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd7784b9ff Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd7c1cdfd9 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd82512aa7 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd9fa59c16 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdda51a55fc Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddad7b69e5 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bddad8254b9 Anti- Signal Transducer And Activator Of Transcription 3 (STAT3) Antibody 50ug 370 € MBS Polyclonals human
DL-STAT3-Mu Mouse Signal Transducer And Activator Of Transcription 3 STAT3 ELISA Kit 96T 904 € DL elisas mouse
DL-STAT3-Ra Rat Signal Transducer And Activator Of Transcription 3 STAT3 ELISA Kit 96T 962 € DL elisas rat
EKU07338 Signal Transducer And Activator Of Transcription 3 (STAT3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU07339 Signal Transducer And Activator Of Transcription 3 (STAT3) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human