| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human STAT3 is produced by our E, coli expression system and the target gene encoding Met1-Asn175 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
21, 8 kD |
| UniProt number: |
P40763 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
STAT3 (C-6His), Signal Transducer Activator of Transcription 3 |
| Short name: |
STAT3 (C-6His), Recombinant Signal Transducer Activator of Transcription 3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Signal Transducer and Activator on Transcription 3, signal transducer and activator on transcription 3 (acute-phase response factor) (C-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ADMIO and APRF and HIES, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006606 and protein import into nucleus and biological process this GO :0006928 and cellular component movement and biological process this GO :0006953 and acute-phase response and biological process this GO :0007165 and signal transduction and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007399 and nervous system development and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0010033 and response to organic substance and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016032 and viral process and biological process this GO :0016310 and phosphorylation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0019903 and protein phosphatase binding and molecular function this GO :0019953 and sexual reproduction and biological process this GO :0030522 and intracellular receptor signaling pathway and biological process this GO :0031730 and CCR5 chemokine receptor binding and molecular function this GO :0032355 and response to estradiol and biological process this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0034097 and response to cytokine and biological process this GO :0035259 and glucocorticoid receptor binding and molecular function this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0042493 and response to drug and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0042755 and eating behavior and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045747 and positive regulation of Notch signaling pathway and biological process this GO :0045820 and negative regulation of glycolytic process and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048708 and astrocyte differentiation and biological process this GO :0060019 and radial glial cell differentiation and biological process this GO :0060396 and growth hormone receptor signaling pathway and biological process this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0070102 and interleukin-6-mediated signaling pathway and biological process this GO :2001223 and negative regulation of neuron migration and biological process, STAT3 and IDBG-50702 and ENSG00000168610 and 6774, STAT3 and IDBG-640197 and ENSBTAG00000021523 and 101910056, Stat3 and IDBG-211637 and ENSMUSG00000004040 and 20848, nuclei, protein dimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0001103 and RNA polymerase II repressing transcription factor binding and molecular function this GO :0001659 and temperature homeostasis and biological process this GO :0001754 and eye photoreceptor cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0004879 and ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006351 and transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0001103 : RNA polymerase II repressing transcription factor binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0004871 : signal transducer activity and also this GO :0004879 : ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0019901 : protein kinase binding and also this GO :0019903 : protein phosphatase binding and also this GO :0031730 : CCR5 chemokine receptor binding and also this GO :0035259 : glucocorticoid receptor binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0046983 : protein dimerization activity, this GO :0001103 : RNA polymerase II repressing transcription factor binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0004871 : signal transducer activity, this GO :0004879 : ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0019901 : protein kinase binding, this GO :0019903 : protein phosphatase binding, this GO :0031730 : CCR5 chemokine receptor binding, this GO :0035259 : glucocorticoid receptor binding, this GO :0043565 : sequence-specific DNA binding, this GO :0044212 : transcription regulatory region DNA binding, this GO :0046983 : protein dimerization activity, 508541, signal transducer and activator of transcription 3 (acute-phase response factor) |
| Identity: |
11364 |
| Gene: |
STAT3 |
More about : STAT3 |
| Long gene name: |
signal transducer and activator of transcription 3 |
| Synonyms gene name: |
signal transducer and activator of transcription 3 (acute-phase response factor) |
| Synonyms: |
APRF |
| Locus: |
17q21, 2 |
| Discovery year: |
1995-11-08 |
| GenBank acession: |
BC014482 |
| Entrez gene record: |
6774 |
| Pubmed identfication: |
7512451 |
| RefSeq identity: |
NM_139276 NM_003150 |
| Classification: |
SH2 domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000150645 |
| Locus Specific Databases: |
STAT3base: Mutation registry for Hyper-IgE syndrome LRG_112 |