| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules |
| Molecular Weight: |
16, 9 kD |
| UniProt number: |
P12272-2 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PTHLH (C-6His), Parathyroid Hormone-Related Protein |
| Short name: |
PTHLH (C-6His), Recombinant Parathyroid Hormone- Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PTHLH (C-6His), sapiens Parathyroid Hormone-Related Protein, recombinant H |
| Alternative technique: |
rec |
| Identity: |
9607 |
| Gene: |
PTHLH |
More about : PTHLH |
| Long gene name: |
parathyroid hormone like hormone |
| Synonyms: |
PTHRP HHM PLP PTHR |
| Synonyms name: |
osteostatin parathyroid hormone-like hormone preproprotein parathyroid hormone-related protein preproprotein |
| Locus: |
12p11, 22 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
5744 |
| Pubmed identfication: |
2708388 |
| RefSeq identity: |
NM_198965 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000169221 |