Recombinant Mouse Tumor Necrosis Factor, TNFα

Contact us
Catalog number: CF09
Price: 2674 €
Supplier: abbex
Product name: Recombinant Mouse Tumor Necrosis Factor, TNFα
Quantity: 1 mg
Other quantities: 1 mg 2486€ 10 µg 156€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Tumor Necrosis Factor alpha is produced by our E, coli expression system and the target gene encoding Asp89-Leu235 is expressed
Molecular Weight: 16, 4 kD
UniProt number: P06804
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TNF&alpha, Tumor Necrosis Factor
Short name: TNF&alpha, Recombinant Mouse Tumor Necrosis Factor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: TNF&alpha, recombinant Mouse Tumor Necrosis Factor
Alternative technique: rec
Identity: 11892
Gene: TNF | More about : TNF
Long gene name: tumor necrosis factor
Synonyms gene: TNFA
Synonyms gene name: member 2) , tumor necrosis factor (TNF superfamily
Synonyms: TNFSF2 DIF TNF-alpha
Synonyms name: TNF superfamily, member 2
Locus: 6p21, 33
Discovery year: 1986-01-01
GenBank acession: X02910
Entrez gene record: 7124
Pubmed identfication: 2413547 6392892
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000031194

Related Products :

MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
CF09 Recombinant Mouse Tumor Necrosis Factor, TNFα 10 µg 156 € novo human
C008 Recombinant Human Tumor Necrosis Factor α, TNFα 1 mg 963 € novo human
CG90 Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His) 10 µg 95 € novo human
CG91 Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His) 1 mg 2486 € novo human
YIAK3110.1 Tumor Necrosis Factor α (TNFα), Clone: tnfa9.9, Mouse Monoclonal antibody-Human; ELISA/RIA/WB 10 ug 153 € accurate-monoclonals human
YIAK3110.2 Tumor Necrosis Factor α (TNFα), Clone: tnfa9.9, Mouse Monoclonal antibody-Human; ELISA/RIA/WB 0.1mg 768 € accurate-monoclonals human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS276474 TNFalpha-IP 2 antibody [C1C3] 100ul 426 € MBS Polyclonals_1 human
TNFA35-R-5 Recombinant (E.Coli) purified mouse Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
CG50 Recombinant Mouse Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a 1 mg 2283 € novo mouse
C694 Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo mouse
CS43 Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5, CD40(C-6His) 10 µg 146 € novo mouse
GWB-36AB53 Tumor Necrosis Factor Alpha (TNF a) recombinant Mouse 1 x 1 vial 579 € genways mouse
YSRTMCA1488EL Tumor Necrosis Factor Alpha (TNF), Clone: MP6-XT22, Rat Mouse Monoclonal antibody-Mouse; frozen, flow/ELISA/functional assays: Low Endotoxin 0.5 mg 532 € accurate-monoclonals mouse
abx167967 Anti-C1q And Tumor Necrosis Factor Related Protein 1 (Recombinant) 10 μg 412 € abbex human
abx166206 Anti-C1q And Tumor Necrosis Factor Related Protein 9 (Recombinant) 50 μg 615 € abbex human
abx263046 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 1 Protein (Recombinant) 10 µg 340 € abbex human
abx263035 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 2 Protein (Recombinant) 2 µg 238 € abbex human
abx263045 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 3 Protein (Recombinant) 2 µg 238 € abbex human
abx262789 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 4 Protein (Recombinant) 2 µg 238 € abbex human
abx263047 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 6 Protein (Recombinant) 1 mg 7662 € abbex human
abx263041 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 7 Protein (Recombinant) 2 µg 238 € abbex human
abx263036 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 8 Protein (Recombinant) 1 mg 7662 € abbex human
abx263037 Anti-Complement C1q Tumor Necrosis Factor-Related Protein 9 Protein (Recombinant) 10 µg 340 € abbex human
abx263014 Anti-Tumor Necrosis Factor alpha , HEK Protein (Recombinant) 1 mg 7314 € abbex human
abx260497 Anti-Tumor Necrosis Factor alpha , His Tag Protein (Recombinant) 1 mg 2674 € abbex human