| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FIBP is produced by our E, coli expression system and the target gene encoding Met1-Asp357 is expressed |
| Molecular Weight: |
41, 8 kD |
| UniProt number: |
O43427 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of 50 mM TrisHCl，pH8, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AMADIGSMTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FIBP, FGF1 Intracellular-Binding Protein |
| Short name: |
FIBP, Recombinant FGF1 Intracellular-Binding Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
FIBP, sapiens fibroblast growth factor 1 (acidic) Intracellular-Binding Protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AFGF and ECGF and ECGF-beta and ECGFA and ECGFB and FGF-1 and FGF-alpha and FGFA and GLIO703 and HBGF-1 and HBGF1, FGF1 and IDBG-51235 and ENSG00000113578 and 2246, FGF1 and IDBG-646137 and ENSBTAG00000005198 and 281160, Fgf1 and IDBG-141787 and ENSMUSG00000036585 and 14164, S100 protein binding, nuclei, this GO :0001525 and angiogenesis and biological process this GO :0001759 and organ induction and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0005104 and fibroblast growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005938 and cell cortex and cellular component this GO :0007165 and signal transduction and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009653 and anatomical structure morphogenesis and biological process this GO :0030324 and lung development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030544 and Hsp70 protein binding and molecular function this GO :0034605 and cellular response to heat and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0044548 and S100 protein binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045542 and positive regulation of cholesterol biosynthetic process and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060681 and branch elongation involved in ureteric bud branching and biological process this GO :0072163 and mesonephric epithelium development and biological process this GO :1902533 and positive regulation of intracellular signal transduction and biological process, this GO :0005104 : fibroblast growth factor receptor binding, this GO :0005104 : fibroblast growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding and also this GO :0030544 : Hsp70 protein binding and also this GO :0044548 : S100 protein binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, this GO :0030544 : Hsp70 protein binding, this GO :0044548 : S100 protein binding, fibroblast growth factor 1 (acidic) |
| Identity: |
3705 |
| Gene: |
FIBP |
More about : FIBP |
| Long gene name: |
FGF1 intracellular binding protein |
| Synonyms gene name: |
fibroblast growth factor (acidic) intracellular binding protein |
| Synonyms: |
FGFIBP |
| Locus: |
11q13, 1 |
| Discovery year: |
1999-06-07 |
| GenBank acession: |
AF010187 |
| Entrez gene record: |
9158 |
| Pubmed identfication: |
9806903 25096995 |
| RefSeq identity: |
NM_198897 |
| Havana BLAST/BLAT: |
OTTHUMG00000166846 |