| Catalog number: | CE85 |
|---|---|
| Price: | 348 € |
| Supplier: | MBS Polyclonals |
| Product name: | Recombinant Human Thioredoxin, TXN (N-6His) |
| Quantity: | 0.12 ml |
| Other quantities: | 10 µg 95€ 50 µg 156€ 500 µg 1186€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Thioredoxin is produced by our E, coli expression system and the target gene encoding Met1-Val105 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: | 13, 9 kD |
| UniProt number: | P10599 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, PH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | TXN (N-6His), Thioredoxin |
| Short name: | TXN (N-6His), Recombinant Thioredoxin |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | TXN (N-6His), sapiens Thioredoxin, recombinant H |
| Alternative technique: | rec |
| Identity: | 12435 |
| Gene: | TXN | More about : TXN |
| Long gene name: | thioredoxin |
| Synonyms: | TRX |
| Locus: | 9q31, 3 |
| Discovery year: | 1990-02-05 |
| GenBank acession: | X77584 |
| Entrez gene record: | 7295 |
| Havana BLAST/BLAT: | OTTHUMG00000020480 |
| CE85 | Recombinant Human Thioredoxin, TXN (N-6His) | 500 µg | 1186 € | novo | human |
| RP-1500H | Recombinant Human Thioredoxin / TXN / SASP Protein | 200μg | 456 € | adv | human |
| GENTAUR-58bde6e247b41 | Monoclonal (IgG) to Human TXN / Thioredoxin / TRX | 0.05 ml | 597 € | MBS mono | human |
| GENTAUR-58bde6e2a65b4 | Monoclonal (IgG) to Human TXN / Thioredoxin / TRX Antibody | 0.05 ml | 597 € | MBS mono | human |
| GENTAUR-58bde6e07dafa | Mouse Monoclonal [clone 3A1] (IgG2b,k) to Human TXN / Thioredoxin / TRX Antibody | 0.05 ml | 597 € | MBS mono | human |
| MBS242371 | PAb (IgG) to Human TXN / Thioredoxin / TRX | 0.05 ml | 597 € | MBS Polyclonals_1 | human |
| GENTAUR-58b8c0322d3db | Bovine Thioredoxin (TXN) | 100ug | 1376 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8c03275fe9 | Bovine Thioredoxin (TXN) | 1000ug | 1376 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8c032c2615 | Bovine Thioredoxin (TXN) | 100ug | 1879 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8c03331fba | Bovine Thioredoxin (TXN) | 1000ug | 1879 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9c0a4d54b7 | Bovine Thioredoxin (TXN) | 100ug | 1376 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9c0a53b7c6 | Bovine Thioredoxin (TXN) | 1000ug | 1376 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9c0a58c16d | Bovine Thioredoxin (TXN) | 100ug | 1879 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9c0a5e4aab | Bovine Thioredoxin (TXN) | 1000ug | 1879 € | MBS Recombinant Proteins | bovine |
| AE57454SH-48 | ELISA test for Sheep Thioredoxin (TXN) | 1x plate of 48 wells | 402 € | abebio | sheep |
| GENTAUR-58ba2e12e37ac | Rat Thioredoxin (Txn) | 100ug | 1376 € | MBS Recombinant Proteins | rat |
| GENTAUR-58ba2e1376294 | Rat Thioredoxin (Txn) | 1000ug | 1376 € | MBS Recombinant Proteins | rat |
| GENTAUR-58ba2e142b829 | Rat Thioredoxin (Txn) | 100ug | 1879 € | MBS Recombinant Proteins | rat |
| GENTAUR-58ba2e1649efe | Rat Thioredoxin (Txn) | 1000ug | 1879 € | MBS Recombinant Proteins | rat |
| AE57454SH | Sheep Thioredoxin (TXN) ELISA Kit | 96 wells plate | 810 € | ab-elisa elisas | sheep |
| AE57454SH-96 | Sheep Thioredoxin (TXN) ELISA Kit | 1x plate of 96 wells | 671 € | abebio | sheep |
| GWB-P1508M | TXN, 1-105 aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| C182 | Recombinant Human Thioredoxin-2, TXN2 (N-6His) | 1 mg | 2283 € | novo | human |
| C673 | Recombinant Human Thioredoxin Domain-Containing Protein 12, TXNDC12, ERp18 (C-6His) | 50 µg | 496 € | novo | human |
| CI27 | Recombinant Human Thioredoxin Domain-Containing Protein 15, TXNDC15 (C-6His) | 1 mg | 2486 € | novo | human |
| LV349355 | TXN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 600 € | ABM lentivectors | human |
| GENTAUR-58bdf0099da65 | Anti- TXN Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58bdf00a15585 | Anti- TXN Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdfb82b1aad | Anti- TXN Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdfb832675f | Anti- TXN Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |