Recombinant Human Thioredoxin, TXN (N-6His)

Contact us
Catalog number: CE85
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Thioredoxin, TXN (N-6His)
Quantity: 0.12 ml
Other quantities: 1 mg 1674€ 10 µg 95€ 50 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Thioredoxin is produced by our E, coli expression system and the target gene encoding Met1-Val105 is expressed with a 6His tag at the N-terminus
Molecular Weight: 13, 9 kD
UniProt number: P10599
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, PH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TXN (N-6His), Thioredoxin
Short name: TXN (N-6His), Recombinant Thioredoxin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TXN (N-6His), sapiens Thioredoxin, recombinant H
Alternative technique: rec
Identity: 12435
Gene: TXN | More about : TXN
Long gene name: thioredoxin
Synonyms: TRX
Locus: 9q31, 3
Discovery year: 1990-02-05
GenBank acession: X77584
Entrez gene record: 7295
Havana BLAST/BLAT: OTTHUMG00000020480

Related Products :

CE85 Recombinant Human Thioredoxin, TXN (N-6His) 500 µg 1186 € novo human
RP-1500H Recombinant Human Thioredoxin / TXN / SASP Protein 200μg 456 € adv human
GENTAUR-58bde6e247b41 Monoclonal (IgG) to Human TXN / Thioredoxin / TRX 0.05 ml 597 € MBS mono human
GENTAUR-58bde6e2a65b4 Monoclonal (IgG) to Human TXN / Thioredoxin / TRX Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde6e07dafa Mouse Monoclonal [clone 3A1] (IgG2b,k) to Human TXN / Thioredoxin / TRX Antibody 0.05 ml 597 € MBS mono human
MBS242371 PAb (IgG) to Human TXN / Thioredoxin / TRX 0.05 ml 597 € MBS Polyclonals_1 human
GENTAUR-58b8c0322d3db Bovine Thioredoxin (TXN) 100ug 1376 € MBS Recombinant Proteins bovine
GENTAUR-58b8c03275fe9 Bovine Thioredoxin (TXN) 1000ug 1376 € MBS Recombinant Proteins bovine
GENTAUR-58b8c032c2615 Bovine Thioredoxin (TXN) 100ug 1879 € MBS Recombinant Proteins bovine
GENTAUR-58b8c03331fba Bovine Thioredoxin (TXN) 1000ug 1879 € MBS Recombinant Proteins bovine
GENTAUR-58b9c0a4d54b7 Bovine Thioredoxin (TXN) 100ug 1376 € MBS Recombinant Proteins bovine
GENTAUR-58b9c0a53b7c6 Bovine Thioredoxin (TXN) 1000ug 1376 € MBS Recombinant Proteins bovine
GENTAUR-58b9c0a58c16d Bovine Thioredoxin (TXN) 100ug 1879 € MBS Recombinant Proteins bovine
GENTAUR-58b9c0a5e4aab Bovine Thioredoxin (TXN) 1000ug 1879 € MBS Recombinant Proteins bovine
AE57454SH-48 ELISA test for Sheep Thioredoxin (TXN) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58ba2e12e37ac Rat Thioredoxin (Txn) 100ug 1376 € MBS Recombinant Proteins rat
GENTAUR-58ba2e1376294 Rat Thioredoxin (Txn) 1000ug 1376 € MBS Recombinant Proteins rat
GENTAUR-58ba2e142b829 Rat Thioredoxin (Txn) 100ug 1879 € MBS Recombinant Proteins rat
GENTAUR-58ba2e1649efe Rat Thioredoxin (Txn) 1000ug 1879 € MBS Recombinant Proteins rat
AE57454SH Sheep Thioredoxin (TXN) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE57454SH-96 Sheep Thioredoxin (TXN) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
GWB-P1508M TXN, 1-105 aa, Recombinant Protein bulk Ask price € genways bulk human
C182 Recombinant Human Thioredoxin-2, TXN2 (N-6His) 1 mg 2283 € novo human
C673 Recombinant Human Thioredoxin Domain-Containing Protein 12, TXNDC12, ERp18 (C-6His) 50 µg 496 € novo human
CI27 Recombinant Human Thioredoxin Domain-Containing Protein 15, TXNDC15 (C-6His) 1 mg 2486 € novo human
LV349355 TXN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
GENTAUR-58bdf0099da65 Anti- TXN Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf00a15585 Anti- TXN Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfb82b1aad Anti- TXN Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfb832675f Anti- TXN Antibody 0.12 ml 348 € MBS Polyclonals human