Recombinant Human Group XVI Phospholipase A1, A2, PLA2G16 (N-6His)

Contact us
Catalog number: CE82
Price: 1569 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Group XVI Phospholipase A1, A2, PLA2G16 (N-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human PLA2G16 is produced by our E, coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus
Molecular Weight: 15, 93 kD
UniProt number: P53816
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: A2, PLA2G16 (N-6His), Group XVI Phospholipase A1
Short name: A2, PLA2G16 (N-6His), Recombinant Group XVI Phospholipase A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: A2, PLA2G16 (N-6His), sapiens family XVI Phospholipase A1, recombinant H
Alternative technique: rec
Identity: 17825
Gene: PLA2G16 | More about : PLA2G16
Long gene name: phospholipase A2 group XVI
Synonyms gene: HRASLS3
Synonyms gene name: HRAS-like suppressor 3 phospholipase A2, group XVI
Synonyms: AdPLA , HREV107 H-REV107-1 HREV107-3 MGC118754
Synonyms name: adipose-specific PLA2
Locus: 11q12, 1 , 3-q13
Discovery year: 2002-01-29
GenBank acession: X92814
Entrez gene record: 11145
Pubmed identfication: 9771974 18614531
RefSeq identity: NM_001128203
Classification: Phospholipases HRAS like suppressor family
Havana BLAST/BLAT: OTTHUMG00000167852

Related Products :

CE82 Recombinant Human Group XVI Phospholipase A1, A2, PLA2G16 (N-6His) 1 mg 2283 € novo human
MBS619587 PLA2G2A (phospholipase A2, group IIA (platelets, synovial fluid)GIIC sPLA2, Group IIA phospholipase A2, MOM1, Non-pancreatic secretory phospholipase A2, NPS-PLA2, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2, membrane associated precursor, PLA2, 100ug 774 € MBS Polyclonals_1 human
MBS242532 Goat Polyclonal to Human PLA2G16 / HRASLS3 Antibody 50ug 597 € MBS Polyclonals_1 human
LV264031 PLA2G16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx904049 Anti-PLA2G16 siRNA 30 nmol 717 € abbex human
abx928771 Anti-PLA2G16 siRNA 30 nmol 717 € abbex human
abx928772 Anti-PLA2G16 siRNA inquire 50 € abbex human
GWB-FC2016 PLA2G16 Over-expression Lysate reagent 1 vial 463 € genways human
MBS623534 PLCL1, NT (Phospholipase C-related But Catalytically Inactive Protein, PRIP, Phospholipase C-deleted In Lung Carcinoma, Inactive Phospholipase C-like Protein 1, PLC-L1) 200ul 603 € MBS Polyclonals_1 human
MBS610453 HMG4 (High Mobility Group 4 (HMG) Transcription Factor, High Mobility Group Protein 2a, HMG2a, High Mobility Group Box 3, HMGB3, MGC90319, Nonhistone Chromosomal Protein HMG4) Antibody 100ul 785 € MBS Polyclonals_1 human
C357 Recombinant Human High Mobility Group Protein B1, HMGB1 (C-6His) 500 µg 1613 € novo human
C987 Recombinant Human High Mobility Group Protein B2, HMGB2 (C-6His) 1 mg 2283 € novo human
C910 Recombinant Human High Mobility Group Protein B3, HMGB3 (C-6His) 500 µg 1613 € novo human
abx166841 Anti-Phospholipase A2, Group IIA Protein (Recombinant) 100 μg 847 € abbex human
abx167678 Anti-Phospholipase A2, Group IID Protein (Recombinant) 100 μg 891 € abbex human
abx167064 Anti-Phospholipase A2, Group X Protein (Recombinant) 100 μg 876 € abbex human
GWB-ASE099 Human Collagen XVI alpha1 Antibody bulk Ask price € genways bulk human
C12221-1 anti-Collagen type XVI alpha 1 chain Antibody 50 Вµg 347 € acr human
C12221-2 anti-Collagen type XVI alpha 1 chain Antibody 0,1 mg 500 € acr human
GENTAUR-58b381d9c1a83 Haplopelma hainanum Hainantoxin-XVI-10 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b381da01129 Haplopelma hainanum Hainantoxin-XVI-10 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b43ac79ee50 Haplopelma hainanum Hainantoxin-XVI-10 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b43ac806be6 Haplopelma hainanum Hainantoxin-XVI-10 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bc443239351 Haplopelma hainanum Hainantoxin-XVI-11 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bc4432844f1 Haplopelma hainanum Hainantoxin-XVI-11 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b8f8427a32d Haplopelma hainanum Hainantoxin-XVI-12 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b8f842d13b5 Haplopelma hainanum Hainantoxin-XVI-12 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b9f5c081893 Haplopelma hainanum Hainantoxin-XVI-12 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b9f5c103225 Haplopelma hainanum Hainantoxin-XVI-12 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b82dd7c42b6 Haplopelma hainanum Hainantoxin-XVI-13 1000ug 1569 € MBS Recombinant Proteins human