Recombinant Human Protein Phosphatase 1C Catalytic Subunit, PPP1CC (N, C-6His)

Contact us
Catalog number: CE80
Price: 528 €
Supplier: abbex
Product name: Recombinant Human Protein Phosphatase 1C Catalytic Subunit, PPP1CC (N, C-6His)
Quantity: 15 nmol
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human PPP1CC is produced by our E, coli expression system and the target gene encoding Met1-Lys323 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 40
UniProt number: P36873
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 1 mM DTT, pH 8, 0 , 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKKLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-6His), PPP1CC (N, Protein Phosphatase 1C Catalytic Subunit
Short name: C-6His), PPP1CC (N, Recombinant Protein Phosphatase 1C Catalytic Subunit
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: C-6His), PPP1CC (N, sapiens Protein Phosphatase 1C Catalytic functionnal sequence, recombinant H
Alternative technique: rec
Identity: 9283
Gene: PPP1CC | More about : PPP1CC
Long gene name: protein phosphatase 1 catalytic subunit gamma
Synonyms gene name: catalytic subunit, catalytic subunit, gamma isoform protein phosphatase 1, gamma isozyme , protein phosphatase 1
Synonyms: PP1C PP1gamma
Locus: 12q24, 11
Discovery year: 1992-12-01
Entrez gene record: 5501
Classification: Protein phosphatase catalytic subunits
Havana BLAST/BLAT: OTTHUMG00000169531

Related Products :

CE80 Recombinant Human Protein Phosphatase 1C Catalytic Subunit, PPP1CC (N, C-6His) 10 µg 202 € novo human
MBS620776 PP1 gamma1 (protein phosphatase 1, catalytic subunit, gamma isoform, PP-1G, Protein Phosphatase 1C Catalytic Subunit, Serine/threonine-protein Phosphatase PP1-gamma Catalytic Subunit) Antibody 100ug 542 € MBS Polyclonals_1 human
GENTAUR-58bd6e2c99600 Dog Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) 100ug 1929 € MBS Recombinant Proteins dog
GENTAUR-58bd6e2ce24a7 Dog Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) 1000ug 1929 € MBS Recombinant Proteins dog
GENTAUR-58bd6e2d3395d Dog Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) 100ug 2442 € MBS Recombinant Proteins dog
GENTAUR-58bd6e2d76e65 Dog Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) 1000ug 2442 € MBS Recombinant Proteins dog
GENTAUR-58bd76d3e59fd Xenopus tropicalis Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (ppp1cc) 100ug 1929 € MBS Recombinant Proteins xenopus
GENTAUR-58bd76d440140 Xenopus tropicalis Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (ppp1cc) 1000ug 1929 € MBS Recombinant Proteins xenopus
GENTAUR-58bd76d480b02 Xenopus tropicalis Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (ppp1cc) 100ug 2442 € MBS Recombinant Proteins xenopus
GENTAUR-58bd76d4d3858 Xenopus tropicalis Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (ppp1cc) 1000ug 2442 € MBS Recombinant Proteins xenopus
MBS621800 PP6C (protein phosphatase 6, catalytic subunit, FLJ92648, MGC12249, PP6C, PPP6, Serine/threonine-protein phosphatase 6 catalytic subunit) Antibody 100ug 597 € MBS Polyclonals_1 human
GWB-P0487F PPP1CC, 1-323aa, Recombinant Protein bulk Ask price € genways bulk human
XW-RP3205 PPP1CC Recombinant Protein 0.02 mg 552 € proscience human
CG02 Recombinant Human Calpain-2 Catalytic Subunit, CAPN2 (C-6His) 500 µg 1755 € novo human
MBS624619 Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) Antibody 1 mililiter 835 € MBS Polyclonals_1 human
LV269707 PPP1CC Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR50375PU-N anti-PPP1CC (1-323, His-tag) Antibody 0,1 mg 1109 € acr human
AR50375PU-S anti-PPP1CC (1-323, His-tag) Antibody 20 Вµg 485 € acr human
AP05036PU-N anti-PPP1CC Antibody 0,1 mg 587 € acr human
AP05037PU-N anti-PPP1CC Antibody 0,1 mg 587 € acr human
GENTAUR-58be099d85f3c Anti- PPP1CC Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be099df0ce4 Anti- PPP1CC Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be09f7f2d22 Anti- PPP1CC Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be09f84d75a Anti- PPP1CC Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3c12ae564 Anti- PPP1CC Antibody 100ug 393 € MBS Polyclonals human
XW-7673 anti-PPP1CC Antibody 0.05 mg 180 € proscience human
AP15244PU-N anti-PPP1CC (C-term) Antibody 0,4 ml 587 € acr human
AP05038PU-N anti-PPP1CC (Isoform gamma-2) Antibody 0,1 mg 587 € acr human
AP15243PU-N anti-PPP1CC (N-term) Antibody 0,4 ml 587 € acr human
abx904173 Anti-PPP1CC siRNA 15 nmol 528 € abbex human