Recombinant Human Peroxiredoxin-4, PRDX4 (N-6His)

Contact us
Catalog number: CE73
Price: 406 €
Supplier: NJS poly
Product name: Recombinant Human Peroxiredoxin-4, PRDX4 (N-6His)
Quantity: 0.1mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Peroxiredoxin-4 is produced by our E, coli expression system and the target gene encoding Trp38-Asn271 is expressed with a 6His tag at the N-terminus
Molecular Weight: 33, 8 kD
UniProt number: Q13162
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRDX4 (N-6His), Peroxiredoxin-4
Short name: PRDX4 (N-6His), Recombinant Peroxiredoxin-4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PRDX4 (N-6His), sapiens Peroxiredoxin-4, recombinant H
Alternative technique: rec
Identity: 17169
Gene: PRDX4 | More about : PRDX4
Long gene name: peroxiredoxin 4
Synonyms: AOE37-2
Locus: Xp22, 11
Discovery year: 2001-11-14
GenBank acession: U25182
Entrez gene record: 10549
Pubmed identfication: 9388242
RefSeq identity: NM_006406
Classification: Peroxiredoxins
Havana BLAST/BLAT: OTTHUMG00000021253
Locus Specific Databases: Mental Retardation database

Related Products :

MBS618043 Peroxiredoxin 4 (Peroxiredoxin-4, PRDX4, PRX-4, Peroxiredoxin IV, Prx-IV, Antioxidant Enzyme AOE372, AOE37-2, Thioredoxin Peroxidase AO372, Thioredoxin-dependent Peroxide Reductase A0372) 0.05 ml 663 € MBS Polyclonals_1 human
CE73 Recombinant Human Peroxiredoxin-4, PRDX4 (N-6His) 50 µg 496 € novo human
CH87 Recombinant Human Peroxiredoxin-4, PRDX4 (N, C-6His) 50 µg 369 € novo human
abx575679 Anti-Human Peroxiredoxin 4 (PRDX4) ELISA Kit 96 tests 789 € abbex human
AE26081HU-48 ELISA test for Human Peroxiredoxin 4 (PRDX4) 1x plate of 48 wells 402 € abebio human
AE26081HU Human Peroxiredoxin 4 (PRDX4) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE26081HU-96 Human Peroxiredoxin 4 (PRDX4) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-PRDX4-Hu Human Peroxiredoxin 4 PRDX4 ELISA Kit 96T 904 € DL elisas human
KT-34609 Human Peroxiredoxin 4 (PRDX4) ELISA kit 96 well plate 1118 € Kamiya human
MBS243615 PAb (IgG) to Human PRDX4 / Peroxiredoxin 4 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
abx572698 Anti-Mouse Peroxiredoxin 4 (PRDX4) ELISA Kit inquire 50 € abbex mouse
AR09413PU-L anti-Peroxiredoxin-4 / PRDX4 (38-271, His-tag) Antibody 0,5 mg 1022 € acr human
AR09413PU-N anti-Peroxiredoxin-4 / PRDX4 (38-271, His-tag) Antibody 0,1 mg 413 € acr human
BB-PA1837 anti-Peroxiredoxin-4 / PRDX4 Antibody 0,1 mg 471 € acr human
GENTAUR-58bdc56cc37e4 Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc73972e5a Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc739ddec4 Anti- Peroxiredoxin 4 (PRDX4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd0cd89c73 Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd0ce01f51 Anti- Peroxiredoxin 4 (PRDX4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd378a261b Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd871c7eda Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd9dd49a0e Anti- Peroxiredoxin 4 (PRDX4) Antibody 100ug 575 € MBS Polyclonals human
AP53439PU-N anti-Peroxiredoxin-4 / PRDX4 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58b89f9392a39 Mouse Peroxiredoxin-4 (Prdx4) 100ug 1702 € MBS Recombinant Proteins mouse
GENTAUR-58b89f94054f1 Mouse Peroxiredoxin-4 (Prdx4) 1000ug 1702 € MBS Recombinant Proteins mouse
GENTAUR-58b89f945bf1d Mouse Peroxiredoxin-4 (Prdx4) 100ug 2216 € MBS Recombinant Proteins mouse
GENTAUR-58b89f94b9466 Mouse Peroxiredoxin-4 (Prdx4) 1000ug 2216 € MBS Recombinant Proteins mouse
DL-PRDX4-Mu Mouse Peroxiredoxin 4 PRDX4 ELISA Kit 96T 921 € DL elisas mouse
R30935 Peroxiredoxin 4 Antibody (PRDX4) 0.1mg 389 € NJS poly human
R32208 Peroxiredoxin 4 Antibody / PRDX4 0.1mg 406 € NJS poly human