| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Peroxiredoxin 4 / PRDX4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
ICC, IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5-1ug/ml, 5ug/ml, ICC: 0, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher |
| Intented use: |
This Peroxiredoxin 4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q13162 |
| Purity: |
Antigen affinity |
| Description: |
Expression of PRDX4, Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation, Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, Jin et al, The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family, Yeast 2-hybrid, alone or with PRDX1, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins, immunoprecipitation, increased the resistance of yeast cells to oxidant-induced toxicity, p65, suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step, PRDX4 (Peroxiredoxin 4) is also known as AOE37-2 |
| Immunogen: |
Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Peroxiredoxin 4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Peroxiredoxin 4 / PRDX4 |
| Short name: |
Peroxiredoxin 4 Antibody / PRDX4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Peroxiredoxin 4 (Antibody to) / PRDX4 |
| Alternative technique: |
antibodies |
| Identity: |
17169 |
| Gene: |
PRDX4 |
More about : PRDX4 |
| Long gene name: |
peroxiredoxin 4 |
| Synonyms: |
AOE37-2 |
| Locus: |
Xp22, 11 |
| Discovery year: |
2001-11-14 |
| GenBank acession: |
U25182 |
| Entrez gene record: |
10549 |
| Pubmed identfication: |
9388242 |
| RefSeq identity: |
NM_006406 |
| Classification: |
Peroxiredoxins |
| Havana BLAST/BLAT: |
OTTHUMG00000021253 |
| Locus Specific Databases: |
Mental Retardation database |