Recombinant Human BCAS2, DAM1 (C-6His, N-T7 tag)

Contact us
Catalog number: CE68
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human BCAS2, DAM1 (C-6His, N-T7 tag)
Quantity: 0.12 ml
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human BCAS2 is produced by our E, coli expression system and the target gene encoding Ala2-Phe225 is expressed with a T7 tag at the N-terminus
Molecular Weight: 28, 58 kD
UniProt number: O75934
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 mM DTT, 200 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MASMTGGQQMGRGSMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDFLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DAM1 (C-6His, N-T7 tag), BCAS2
Short name: DAM1 (C-6His, N-T7 tag), Recombinant BCAS2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: tag
Species: Humans, Human
Alternative name: DAM1 (C-6His, N-T7 detection labelled), sapiens BCAS2, recombinant H
Alternative technique: rec
Identity: 975
Gene: BCAS2 | More about : BCAS2
Long gene name: BCAS2, pre-mRNA processing factor
Synonyms gene name: breast carcinoma amplified sequence 2
Synonyms: DAM1 SPF27 Snt309
Synonyms name: DNA amplified in mammary carcinoma 1
Locus: 1p13, 2
Discovery year: 2000-01-31
GenBank acession: AB020623
Entrez gene record: 10286
Pubmed identfication: 9731529 10403562
RefSeq identity: NM_005872
Classification: NineTeen complex
Havana BLAST/BLAT: OTTHUMG00000011898

Related Products :

CE68 Recombinant Human BCAS2, DAM1 (C-6His, N-T7 tag) 10 µg 202 € novo human
GENTAUR-58bdb73265805 Candida albicans DASH complex subunit DAM1 (DAM1) 100ug 1812 € MBS Recombinant Proteins human
GENTAUR-58bdb732da69d Candida albicans DASH complex subunit DAM1 (DAM1) 1000ug 1812 € MBS Recombinant Proteins human
GENTAUR-58bdb73341441 Candida albicans DASH complex subunit DAM1 (DAM1) 100ug 2326 € MBS Recombinant Proteins human
GENTAUR-58bdb7338ee8e Candida albicans DASH complex subunit DAM1 (DAM1) 1000ug 2326 € MBS Recombinant Proteins human
AR09854PU-N anti-BCAS2 / DAM1 (1-225, His-tag) Antibody 50 Вµg 1138 € acr human
AR09854PU-S anti-BCAS2 / DAM1 (1-225, His-tag) Antibody 10 Вµg 485 € acr human
CPA2466-100ul anti-BCAS2 / DAM1 Antibody 0,1 ml 442 € acr human
CPA2466-200ul anti-BCAS2 / DAM1 Antibody 0,2 ml 688 € acr human
CPA2466-30ul anti-BCAS2 / DAM1 Antibody 30 Вµl 326 € acr human
AP23506PU-N anti-BCAS2 / DAM1 (C-term) Antibody 50 Вµg 732 € acr human
AP30126CP-N anti-BCAS2 / DAM1 Control Peptide Antibody 50 Вµg 282 € acr human
abx263295 Anti-BCAS2 Protein (Recombinant) 1 µg 238 € abbex human
GWB-P1124F BCAS2, 1-225aa, Recombinant Protein bulk Ask price € genways bulk human
MBS243228 Anti-Human BCAS2 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-BSP400 BCAS2 Human Protein bulk Ask price € genways bulk human
LV087982 BCAS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV087983 BCAS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV087984 BCAS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV087985 BCAS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV087987 BCAS2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV087986 BCAS2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AE54590HU-48 ELISA test for Human Pre-mRNA-splicing factor SPF27 (BCAS2) 1x plate of 48 wells 373 € abebio human
AE54590HU-96 Human Pre-mRNA-splicing factor SPF27 (BCAS2) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS619150 Vesicular Stomatitis Virus Glycoprotein, Epitope Tag (Vesicular Stomatitis Virus Glycoprotein Tag, VSV Epitope Tag, VSV Tag, VSV-G Epitope Tag, VSV G, VSV-G) (FITC) Antibody 100ug 685 € MBS Polyclonals_1 virus
A03B0034 anti-BCAS2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bde9f113556 Anti- BCAS2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bde9f14d9ae Anti- BCAS2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea82a519d Anti- BCAS2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdea8309c20 Anti- BCAS2 Antibody 0.12 ml 348 € MBS Polyclonals human