Recombinant Human ADP-Ribosylarginine Hydrolase, ADPRH, ARH1 (N-6His)

Contact us
Catalog number: CE44
Price: 558 €
Supplier: MBS Polyclonals
Product name: Recombinant Human ADP-Ribosylarginine Hydrolase, ADPRH, ARH1 (N-6His)
Quantity: 0.2 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ADP-Ribosylarginine Hydrolase is produced by our E, coli expression system and the target gene encoding Met1-Leu357 is expressed with a 6His tag at the N-terminus
Molecular Weight: 41, 67 kD
UniProt number: P54922
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, 50% Glycerol, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ADPRH, ARH1 (N-6His), ADP-Ribosylarginine Hydrolase
Short name: ADPRH, ARH1 (N-6His), Recombinant ADP-Ribosylarginine Hydrolase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ADPRH, ARH1 (N-6His), sapiens ADP-Ribosylarginine Hydrolase, recombinant H
Alternative technique: rec
Identity: 269
Gene: ADPRH | More about : ADPRH
Long gene name: ADP-ribosylarginine hydrolase
Synonyms: ARH1
Synonyms name: [Protein ADP-ribosylarginine] hydrolase
Locus: 3q13, 33
Discovery year: 1997-06-20
GenBank acession: L13291
Entrez gene record: 141
Pubmed identfication: 8349667 12070318
RefSeq identity: NM_001125
Havana BLAST/BLAT: OTTHUMG00000159420

Related Products :

CE44 Recombinant Human ADP-Ribosylarginine Hydrolase, ADPRH, ARH1 (N-6His) 1 mg 2283 € novo human
AE24049BO-96 Bovine [Protein ADP-ribosylarginine] hydrolase (ADPRH) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE24049BO-48 ELISA test for Bovine [Protein ADP-ribosylarginine] hydrolase (ADPRH) 1x plate of 48 wells 402 € abebio bovine
RP-1734H Recombinant Human ADPRH / ARH1 Protein (His Tag) 20μg 572 € adv human
AR50457PU-N anti-ADPRH / ARH1 (1-357, His-tag) Antibody 0,5 mg 1109 € acr human
AR50457PU-S anti-ADPRH / ARH1 (1-357, His-tag) Antibody 0,1 mg 485 € acr human
YSRTMCA5411Z ADP-Ribosylarginine Hydrolase, Mouse Monoclonal antibody-; Clone: 1F11 0.1 mg Ask price € accurate-monoclonals mouse
AE24053BO-96 Bovine [Protein ADP-ribosylarginine] hydrolase-like protein 1 (ADPRHL1) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE24053BO-48 ELISA test for Bovine [Protein ADP-ribosylarginine] hydrolase-like protein 1 (ADPRHL1) 1x plate of 48 wells 402 € abebio bovine
GWB-P0405B ADPRH, 1-357aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58b8fe2e23144 Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b8fe2e70e7c Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 1000ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b8fe2ed023d Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 100ug 2719 € MBS Recombinant Proteins human
GENTAUR-58b8fe2f3b3f0 Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 1000ug 2719 € MBS Recombinant Proteins human
GENTAUR-58b9ff1e79283 Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b9ff1f0cfd2 Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 1000ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b9ff1f951f9 Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 100ug 2719 € MBS Recombinant Proteins human
GENTAUR-58b9ff2057f5b Schizosaccharomyces pombe Probable NADPH:adrenodoxin oxidoreductase, mitochondrial (arh1) 1000ug 2719 € MBS Recombinant Proteins human
LV070045 ADPRH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV070046 ADPRH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV070047 ADPRH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV070048 ADPRH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV070050 ADPRH Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV070049 ADPRH Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-MS381C ADPRH antibody 1 vial 521 € genways human
GWB-577A9C ADPRH Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GENTAUR-58bdfbc4320e3 Anti- ADPRH Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfbc48f641 Anti- ADPRH Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be318f50d16 Anti- ADPRH Antibody 0.2 ml 603 € MBS Polyclonals human
GENTAUR-58be53bf55317 Anti- ADPRH Antibody 0.2 mg 558 € MBS Polyclonals human