Recombinant Human Galactokinase, GALK1 (C-6His)

Catalog number:	CE38 Buy Now
Price:	528 €
Supplier:	abbex
Product name:	Recombinant Human Galactokinase, GALK1 (C-6His)
Quantity:	15 nmol
Other quantities:	1 mg 2283€ 500 µg 1613€
Related search:	human galk galactokinase sapiens chis alternative expression

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Galactokinase is produced by our E, coli expression system and the target gene encoding Met1-Leu392 is expressed with a 6His tag at the C-terminus
Molecular Weight:	3 kD, 43
UniProt number:	P51570
State of the product:	Liquid
Shipping conditions:	Dry Ice/ice packs
Formulation:	150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCLLEHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	GALK1 (C-6His), Galactokinase
Short name:	GALK1 (C-6His), Recombinant Galactokinase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	GALK1 (C-6His), sapiens Galactokinase, recombinant H
Alternative technique:	rec
Identity:	4118
Gene:	GALK1 | More about : GALK1
Long gene name:	galactokinase 1
Synonyms gene:	GALK
Locus:	17q25, 1
Discovery year:	1986-01-01
Entrez gene record:	2584
Pubmed identfication:	7670469
Havana BLAST/BLAT:	OTTHUMG00000179832

• #human
• #galk
• #galactokinase
• #sapiens
• #chis
• #alternative
• #expression