Recombinant Human GADD45β, GADD45B (N-6His)

Contact us
Catalog number: CE37
Price: 528 €
Supplier: abbex
Product name: Recombinant Human GADD45β, GADD45B (N-6His)
Quantity: 15 nmol
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GADD45B is produced by our E, coli expression system and the target gene encoding Met1-Arg160 is expressed with a 6His tag at the N-terminus
Molecular Weight: 20 kD
UniProt number: O75293
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GADD45B (N-6His), GADD45&beta
Short name: GADD45B (N-6His), Recombinant GADD45&beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b (N-6His), growth arrest and Desoxyribonucleic acid-damage-inducible, sapiens GADD45&beta, recombinant H
Alternative technique: rec
Alternative to gene target: GADD45B and IDBG-16168 and ENSG00000099860 and 4616, GADD45B and IDBG-644512 and ENSBTAG00000025462 and 618405, GADD45BETA and MYD118, Gadd45b and IDBG-176557 and ENSMUSG00000015312 and 17873, beta, nuclei, protein binding, this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000186 and activation of MAPKK activity and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0006950 and response to stress and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0030154 and cell differentiation and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, growth arrest and DNA-damage-inducible
Identity: 4096
Gene: GADD45B | More about : GADD45B
Long gene name: growth arrest and DNA damage inducible beta
Synonyms gene: MYD118
Synonyms gene name: beta , growth arrest and DNA-damage-inducible
Synonyms: GADD45BETA DKFZP566B133
Synonyms name: myeloid differentiation primary response growth arrest and DNA-damage-inducible beta
Locus: 19p13, 3
Discovery year: 1994-01-10
GenBank acession: AF090950
Entrez gene record: 4616
Pubmed identfication: 1899477 9827804
RefSeq identity: NM_015675
Havana BLAST/BLAT: OTTHUMG00000180434

Related Products :

CE37 Recombinant Human GADD45β, GADD45B (N-6His) 500 µg 1613 € novo human
GWB-P0190H GADD45B, 1-160aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP489 GADD45B Human Protein bulk Ask price € genways bulk human
LV165662 GADD45B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV165663 GADD45B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV165664 GADD45B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV165665 GADD45B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV165667 GADD45B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV165666 GADD45B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
GENTAUR-58b9cb9919dc9 Human Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58b9cb9aa8d37 Human Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58b9cb9b8fe33 Human Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58b9cb9be0511 Human Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B) 1000ug 2022 € MBS Recombinant Proteins human
AR09108PU-L anti-GADD45B (1-160) Antibody 0,5 mg 833 € acr human
AR09108PU-N anti-GADD45B (1-160) Antibody 0,1 mg 384 € acr human
CPA2987-100ul anti-GADD45B Antibody 0,1 ml 442 € acr human
CPA2987-200ul anti-GADD45B Antibody 0,2 ml 688 € acr human
CPA2987-30ul anti-GADD45B Antibody 30 Вµl 326 € acr human
GADD-101AP anti-GADD45B Antibody 100 µg 357 € fabgen human
GENTAUR-58bdeaf67c9b7 Anti- GADD45B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeaf6d446b Anti- GADD45B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be00b3808c0 Anti- GADD45B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be00b3db8a1 Anti- GADD45B Antibody 0.12 ml 348 € MBS Polyclonals human
abx215511 Anti-GADD45B Antibody 100 μg 311 € abbex human
GADD-BIOTIN anti-GADD45B Antibody BIOTIN 100 µg 456 € fabgen human
GADD-FITC anti-GADD45B Antibody FITC 100 µg 456 € fabgen human
AP10078PU-N anti-GADD45B (C-term) Antibody 0,2 ml 659 € acr human
AP10078CP-N anti-GADD45B Control Peptide Antibody 0,25 mg 413 € acr human
GENTAUR-58be6407b523a Anti-GADD45B (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx917467 Anti-GADD45B siRNA 15 nmol 528 € abbex human