Recombinant Human GADD45γ, GADD45G (N-6His)

Contact us
Catalog number: CE26
Price: 1036 €
Supplier: abbex
Product name: Recombinant Human GADD45γ, GADD45G (N-6His)
Quantity: 96 tests
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GADD45G is produced by our E, coli expression system and the target gene encoding Met1-Glu159 is expressed with a 6His tag at the N-terminus
Molecular Weight: 19, 28 kD
UniProt number: O95257
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GADD45G (N-6His), GADD45&gamma
Short name: GADD45G (N-6His), Recombinant GADD45&gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: g (N-6His), growth arrest and Desoxyribonucleic acid-damage-inducible, sapiens GADD45&gamma, recombinant H
Alternative technique: rec
Alternative to gene target: CR6 and DDIT2 and GADD45gamma and GRP17, GADD45G and IDBG-637039 and ENSBTAG00000003033 and 504939, GADD45G and IDBG-75478 and ENSG00000130222 and 10912, Gadd45g and IDBG-152599 and ENSMUSG00000021453 and 23882, gamma, nuclei, protein binding, this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000186 and activation of MAPKK activity and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0006950 and response to stress and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0030154 and cell differentiation and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, growth arrest and DNA-damage-inducible
Identity: 4097
Gene: GADD45G | More about : GADD45G
Long gene name: growth arrest and DNA damage inducible gamma
Synonyms gene name: gamma , growth arrest and DNA-damage-inducible
Synonyms: DDIT2 GADD45gamma GRP17 CR6
Synonyms name: 17 kD growth arrest and DNA-damage-inducible gamma , gadd-related protein
Locus: 9q22, 2
Discovery year: 1999-09-06
GenBank acession: D83023
Entrez gene record: 10912
Pubmed identfication: 9827804 10496071
RefSeq identity: NM_006705
Havana BLAST/BLAT: OTTHUMG00000020187

Related Products :

CE26 Recombinant Human GADD45γ, GADD45G (N-6His) 50 µg 496 € novo human
MBS421581 Goat anti-GADD45gamma (aa 123 to 133) Antibody 100ug 299 € MBS Polyclonals_1 human
MBS421580 Goat anti-GADD45gamma (aa 18 to 28) Antibody 100ug 299 € MBS Polyclonals_1 human
GWB-P0189G GADD45G, 1-159aa, Recombinant Protein bulk Ask price € genways bulk human
LV165668 GADD45G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV165669 GADD45G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV165670 GADD45G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV165671 GADD45G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV165673 GADD45G Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV165672 GADD45G Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bb87297f44d Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bb8729cb350 Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bb872a2858e Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bb872a6c5df Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) 1000ug 2022 € MBS Recombinant Proteins human
AR09109PU-L anti-GADD45G (1-159) Antibody 0,5 mg 833 € acr human
AR09109PU-N anti-GADD45G (1-159) Antibody 0,1 mg 384 € acr human
C13057-1 anti-GADD45G Antibody 50 Вµg 347 € acr human
C13057-2 anti-GADD45G Antibody 0,1 mg 500 € acr human
GENTAUR-58bdfb9e2bd80 Anti- GADD45G Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfb9e906f1 Anti- GADD45G Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfc7e74fa4 Anti- GADD45G Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfc7ed1341 Anti- GADD45G Antibody 0.12 ml 348 € MBS Polyclonals human
XW-7211 anti-GADD45G Antibody 0.05 mg 180 € proscience human
abx149539 Anti-GADD45G Antibody 100 μg 311 € abbex human
AP51756PU-N anti-GADD45G (N-term) Antibody 0,4 ml 587 € acr human
abx917471 Anti-GADD45G siRNA 30 nmol 717 € abbex human
abx917472 Anti-GADD45G siRNA inquire 50 € abbex human
GENTAUR-58bdf19e85891 Anti- GADD45G-Specific Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf19ee4fdf Anti- GADD45G-Specific Antibody 0.06 ml 265 € MBS Polyclonals human
abx154052 Anti-Mouse GADD45g ELISA Kit 96 tests 1036 € abbex mouse