| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human GADD45G is produced by our E, coli expression system and the target gene encoding Met1-Glu159 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
19, 28 kD |
| UniProt number: |
O95257 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
GADD45G (N-6His), GADD45&gamma |
| Short name: |
GADD45G (N-6His), Recombinant GADD45&gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
g (N-6His), growth arrest and Desoxyribonucleic acid-damage-inducible, sapiens GADD45&gamma, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CR6 and DDIT2 and GADD45gamma and GRP17, GADD45G and IDBG-637039 and ENSBTAG00000003033 and 504939, GADD45G and IDBG-75478 and ENSG00000130222 and 10912, Gadd45g and IDBG-152599 and ENSMUSG00000021453 and 23882, gamma, nuclei, protein binding, this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000186 and activation of MAPKK activity and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0006950 and response to stress and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0030154 and cell differentiation and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, growth arrest and DNA-damage-inducible |
| Identity: |
4097 |
| Gene: |
GADD45G |
More about : GADD45G |
| Long gene name: |
growth arrest and DNA damage inducible gamma |
| Synonyms gene name: |
gamma , growth arrest and DNA-damage-inducible |
| Synonyms: |
DDIT2 GADD45gamma GRP17 CR6 |
| Synonyms name: |
17 kD growth arrest and DNA-damage-inducible gamma , gadd-related protein |
| Locus: |
9q22, 2 |
| Discovery year: |
1999-09-06 |
| GenBank acession: |
D83023 |
| Entrez gene record: |
10912 |
| Pubmed identfication: |
9827804 10496071 |
| RefSeq identity: |
NM_006705 |
| Havana BLAST/BLAT: |
OTTHUMG00000020187 |