| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human B-Cell Linker Protein is produced by our E, coli expression system and the target gene encoding Met1-Ser456 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
5 kD, 51 |
| UniProt number: |
Q8WV28 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BLNK (C-6His), B Linker Protein |
| Short name: |
BLNK (C-6His), Recombinant B-Cell Linker Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B-cell linker (C-6His), sapiens B-cellular Linker Protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BLNK and IDBG-83724 and ENSG00000095585 and 29760, BT, Blnk and IDBG-165316 and ENSMUSG00000061132 and 17060, Plasma membranes, protein binding, this GO :0005068 and transmembrane receptor protein tyrosine kinase adaptor activity and molecular function this GO :0005070 and SH3/SH2 adaptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0009967 and positive regulation of signal transduction and biological process this GO :0030183 and B cell differentiation and biological process this GO :0035556 and intracellular signal transduction and biological process, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity and also this GO :0005070 : SH3/SH2 adaptor activity and also this GO :0005515 : protein binding, this GO :0005070 : SH3/SH2 adaptor activity, this GO :0005515 : protein binding, 24520 and IDBG-638042 and ENSBTAG00000021358 and 510393, B-cell linker |
| Identity: |
14211 |
| Gene: |
BLNK |
More about : BLNK |
| Long gene name: |
B-cell linker |
| Synonyms: |
SLP65 Ly57 SLP-65 BLNK-s BASH bca |
| Synonyms name: |
B-cell adapter containing a SH2 domain protein B-cell activation Src homology [SH2] domain-containing leukocyte protein of 65 kD B cell adaptor containing SH2 domain |
| Locus: |
10q24, 1 |
| Discovery year: |
2001-07-16 |
| GenBank acession: |
AF068180 |
| Entrez gene record: |
29760 |
| Pubmed identfication: |
9697839 10583958 |
| RefSeq identity: |
NM_013314 |
| Classification: |
SH2 domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000018827 |
| Locus Specific Databases: |
BLNKbase: Mutation registry for BLNK deficiency LRG_21 |