Recombinant Human B-Cell Linker Protein, BLNK (C-6His)

Contact us
Catalog number: CE25
Price: 238 €
Supplier: abbex
Product name: Recombinant Human B-Cell Linker Protein, BLNK (C-6His)
Quantity: 5 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human B-Cell Linker Protein is produced by our E, coli expression system and the target gene encoding Met1-Ser456 is expressed with a 6His tag at the C-terminus
Molecular Weight: 5 kD, 51
UniProt number: Q8WV28
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BLNK (C-6His), B Linker Protein
Short name: BLNK (C-6His), Recombinant B-Cell Linker Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B-cell linker (C-6His), sapiens B-cellular Linker Protein, recombinant H
Alternative technique: rec
Alternative to gene target: BLNK and IDBG-83724 and ENSG00000095585 and 29760, BT, Blnk and IDBG-165316 and ENSMUSG00000061132 and 17060, Plasma membranes, protein binding, this GO :0005068 and transmembrane receptor protein tyrosine kinase adaptor activity and molecular function this GO :0005070 and SH3/SH2 adaptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0009967 and positive regulation of signal transduction and biological process this GO :0030183 and B cell differentiation and biological process this GO :0035556 and intracellular signal transduction and biological process, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity and also this GO :0005070 : SH3/SH2 adaptor activity and also this GO :0005515 : protein binding, this GO :0005070 : SH3/SH2 adaptor activity, this GO :0005515 : protein binding, 24520 and IDBG-638042 and ENSBTAG00000021358 and 510393, B-cell linker
Identity: 14211
Gene: BLNK | More about : BLNK
Long gene name: B-cell linker
Synonyms: SLP65 Ly57 SLP-65 BLNK-s BASH bca
Synonyms name: B-cell adapter containing a SH2 domain protein B-cell activation Src homology [SH2] domain-containing leukocyte protein of 65 kD B cell adaptor containing SH2 domain
Locus: 10q24, 1
Discovery year: 2001-07-16
GenBank acession: AF068180
Entrez gene record: 29760
Pubmed identfication: 9697839 10583958
RefSeq identity: NM_013314
Classification: SH2 domain containing
Havana BLAST/BLAT: OTTHUMG00000018827
Locus Specific Databases: BLNKbase: Mutation registry for BLNK deficiency LRG_21

Related Products :

CE25 Recombinant Human B-Cell Linker Protein, BLNK (C-6His) 50 µg 496 € novo human
GENTAUR-58bd63bd7724e Human B-cell linker protein (BLNK) 100ug 2271 € MBS Recombinant Proteins human
GENTAUR-58bd63bdcd746 Human B-cell linker protein (BLNK) 1000ug 2271 € MBS Recombinant Proteins human
GENTAUR-58bd63be28d5a Human B-cell linker protein (BLNK) 100ug 2785 € MBS Recombinant Proteins human
GENTAUR-58bd63be7b159 Human B-cell linker protein (BLNK) 1000ug 2785 € MBS Recombinant Proteins human
AR09855PU-L anti-B-cell linker protein / BLNK (1-456, His-tag) Antibody 0,5 mg 1138 € acr human
AR09855PU-N anti-B-cell linker protein / BLNK (1-456, His-tag) Antibody 0,1 mg 485 € acr human
AM06644SU-N anti-B-cell linker protein / BLNK Antibody 0,1 ml 674 € acr human
AP05906PU-N anti-B-cell linker protein / BLNK Antibody 0,1 mg 543 € acr human
B0620-1 anti-B-cell linker protein / BLNK Antibody 50 Вµg 347 € acr human
B0620-2 anti-B-cell linker protein / BLNK Antibody 0,1 mg 500 € acr human
CPA2642-100ul anti-B-cell linker protein / BLNK Antibody 0,1 ml 442 € acr human
CPA2642-200ul anti-B-cell linker protein / BLNK Antibody 0,2 ml 688 € acr human
CPA2642-30ul anti-B-cell linker protein / BLNK Antibody 30 Вµl 326 € acr human
SP3004P anti-B-cell linker protein / BLNK Antibody 0,1 mg 427 € acr human
AP17153PU-N anti-B-cell linker protein / BLNK (Center) Antibody 0,4 ml 587 € acr human
AP55915PU-N anti-B-cell linker protein / BLNK pTyr96 Antibody 0,1 ml 543 € acr human
AP55915PU-S anti-B-cell linker protein / BLNK pTyr96 Antibody 50 Вµl 442 € acr human
YM2082 Non-T-Cell Activation Linker (NtAl), Linker of activated B-Cells (LAB), 30kD, Clone: NAP-03, Mouse Monoclonal antibody-Human (NO X w/Mouse), IP/WB (non-reducing) 0.1mg 848 € accurate-monoclonals mouse
YM2083 Non-T-Cell Activation Linker (NtAl), Linker of activated B-Cells (LAB), c-domain, 30kD, Clone: NAP-07, Mouse Monoclonal antibody-Human, Mouse, IP/WB (non-reducing) 0.1mg 848 € accurate-monoclonals mouse
MBS620549 CLASP1, phosphorylated (Ser600) (Cytoplasmic linker associated protein 1, CLIP-associating protein 1, Cytoplasmic linker-associated protein 1, DKFZp686D1968, DKFZp686H2039, FLJ33821, FLJ41222, hOrbit1, KIAA0622, MAST1, MGC131895, Multiple asters homolog 1 Antibody 100ul 603 € MBS Polyclonals_1 human
23311 Rink Amide Linker (Knorr Linker) extrapurified 1 Gms 270 € Research sys human
CA38 Recombinant Human Linker for Activation of T-Cells Family Member 2, LAT2 (C-6His) 1 mg 2283 € novo human
RP-0135H Recombinant Human BLNK / Ly-57 / SLP-65 Protein (His Tag) 20μg 572 € adv human
GWB-P1123E BLNK, 1-456aa, Recombinant Protein bulk Ask price € genways bulk human
MBS622840 Bcl 7A (B Cell CLL/lymphoma 7 Protein Family Member A, B cell CLL/lymphoma 7A, B-cell CLL/lymphoma 7A, Bcl7A, B Cell CLL/lymphoma 7, B-cell CLL/lymphoma 7, BCL7) 100ug 763 € MBS Polyclonals_1 human
abx260855 Anti-B-Cell Linker Protein (Recombinant) 20 µg 340 € abbex human
abx166552 Anti-Linker For Activation Of T-Cell Protein (Recombinant) 50 μg 586 € abbex human
abx168563 Anti-Linker For Activation Of T-Cell Protein (Recombinant) 100 μg 963 € abbex human
abx260597 Anti-Non-T-cell Activation Linker Protein (Recombinant) 5 µg 238 € abbex human