Recombinant Human Mothers Against Decapentaplegic Homolog 3, SMAD3 (N-6His-Flag)

Contact us
Catalog number: CE17
Price: 412 €
Supplier: abbex
Product name: Recombinant Human Mothers Against Decapentaplegic Homolog 3, SMAD3 (N-6His-Flag)
Quantity: 10 μg
Other quantities: 1 mg 1674€ 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Flag tag at the N-terminus, Recombinant Human Mothers Against Decapentaplegic Homolog 3 is produced by our E, coli expression system and the target gene encoding Ser2-Ser425 is expressed with a 6His
Molecular Weight: 3 kD, 50
UniProt number: P84022
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of 20 mM PB, 5, 500 mM sodium chloride, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRGSHHHHHHGSDYKDDDDKSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties:  , Also separation of , Depending on the epitopes used human ELISA kits can be cross reactive to many other species, FLAGS are also used in the isolation of , For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies, Human proteins, It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray, Mainly analyzed are human serum, Modern , Suitable for in vivo use in cells, This FLAG-tags have the sequence DYKDDDDK motiv, because its mild purification procedure tends not to disrupt such complexes, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, or , or , overexpressed proteins from cell lysates is done by FLAG go HIS tags, plasma, primarily , saliva, urine,  , (Homo sapiens, An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, FLAG epitope that is a polypeptide , FLAG octapeptide, Homo sapiens sapiens), These tags are very useful to do protein purification by , affinity chromatography, humans , protein complexes , protein tag , recombinant, recombinant DNA, ssp, that can be added to a protein using , with multiple subunits
Conjugation: Flag
Group: recombinants
Gene target: SMAD3 (N-6His, Mothers Against Decapentaplegic Homolog 3
Short name: SMAD3 (N-6His- ), Recombinant Mothers Against Decapentaplegic Homolog 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: Flag
Species: Humans, Human
Alternative name: SMAD family member 3 (N-6His-Flag), sapiens Mothers Against Decapentaplegic Homolog 3, recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006367 and transcription initiation from RNA polymerase II promoter and biological process this GO :0006810 and transport and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007369 and gastrulation and biological process this GO :0007492 and endoderm development and biological process this GO :0008013 and beta-catenin binding and molecular function this GO :0008134 and transcription factor binding and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0010467 and gene expression and biological process this GO :0010694 and positive regulation of alkaline phosphatase activity and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0016202 and regulation of striated muscle tissue development and biological process this GO :0017015 and regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0019049 and evasion or tolerance of host defenses by virus and biological process this GO :0019899 and enzyme binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0019902 and phosphatase binding and molecular function this GO :0023019 and signal transduction involved in regulation of gene expression and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030618 and transforming growth factor beta receptor, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0048340 and paraxial mesoderm morphogenesis and biological process this GO :0048589 and developmental growth and biological process this GO :0048617 and embryonic foregut morphogenesis and biological process this GO :0048701 and embryonic cranial skeleton morphogenesis and biological process this GO :0050678 and regulation of epithelial cell proliferation and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050821 and protein stabilization and biological process this GO :0050927 and positive regulation of positive chemotaxis and biological process this GO :0051098 and regulation of binding and biological process this GO :0051496 and positive regulation of stress fiber assembly and biological process this GO :0051894 and positive regulation of focal adhesion assembly and biological process this GO :0060039 and pericardium development and biological process this GO :0060290 and transdifferentiation and biological process this GO :0061045 and negative regulation of wound healing and biological process this GO :0070306 and lens fiber cell differentiation and biological process this GO :0070410 and co-SMAD binding and molecular function this GO :0070412 and R-SMAD binding and molecular function this GO :0071141 and SMAD protein complex and cellular component this GO :0071144 and SMAD2-SMAD3 protein complex and cellular component this GO :0090263 and positive regulation of canonical Wnt signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097296 and activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway and biological process this GO :1901313 and positive regulation of gene expression involved in extracellular matrix organization and biological process, HSPC193 and HsT17436 and JV15-2 and LDS1C and LDS3 and MADH3, SMAD3 and IDBG-18366 and ENSG00000166949 and 4088, SMAD3 and IDBG-645466 and ENSBTAG00000012599 and 515125, Smad3 and IDBG-175693 and ENSMUSG00000032402 and 17127, nuclei, pathway-specific cytoplasmic mediator activity, pathway-specific cytoplasmic mediator activity and also this GO :0031490 : chromatin DNA binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0035326 : enhancer binding and also this GO :0042803 : protein homodimerization activity and also this GO :0043130 : ubiquitin binding and also this GO :0043425 : bHLH transcription factor binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0046332 : SMAD binding and also this GO :0070410 : co-SMAD binding and also this GO :0070412 : R-SMAD binding, pathway-specific cytoplasmic mediator activity and molecular function this GO :0030878 and thyroid gland development and biological process this GO :0031053 and primary miRNA processing and biological process this GO :0031490 and chromatin DNA binding and molecular function this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032332 and positive regulation of chondrocyte differentiation and biological process this GO :0032731 and positive regulation of interleukin-1 beta production and biological process this GO :0032909 and regulation of transforming growth factor beta2 production and biological process this GO :0032916 and positive regulation of transforming growth factor beta3 production and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0033689 and negative regulation of osteoblast proliferation and biological process this GO :0035326 and enhancer binding and molecular function this GO :0035413 and positive regulation of catenin import into nucleus and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0038092 and nodal signaling pathway and biological process this GO :0042060 and wound healing and biological process this GO :0042110 and T cell activation and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042993 and positive regulation of transcription factor import into nucleus and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043130 and ubiquitin binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0043235 and receptor complex and cellular component this GO :0043425 and bHLH transcription factor binding and molecular function this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000790 and nuclear chromatin and cellular component this GO :0000987 and core promoter proximal region sequence-specific DNA binding and molecular function this GO :0000988 and protein binding transcription factor activity and molecular function this GO :0001102 and RNA polymerase II activating transcription factor binding and molecular function this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001707 and mesoderm formation and biological process this GO :0001756 and somitogenesis and biological process this GO :0001889 and liver development and biological process this GO :0001933 and negative regulation of protein phosphorylation and biological process this GO :0001947 and heart looping and biological process this GO :0002076 and osteoblast development and biological process this GO :0002520 and immune system development and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005637 and nuclear inner membrane and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006351 and transcription, this GO :0000987 : core promoter proximal region sequence-specific DNA binding, this GO :0000987 : core promoter proximal region sequence-specific DNA binding and also this GO :0000988 : protein binding transcription factor activity and also this GO :0001102 : RNA polymerase II activating transcription factor binding and also this GO :0003677 : DNA binding and also this GO :0003682 : chromatin binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0008013 : beta-catenin binding and also this GO :0008134 : transcription factor binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding and also this GO :0019901 : protein kinase binding and also this GO :0019902 : phosphatase binding and also this GO :0030618 : transforming growth factor beta receptor, this GO :0000988 : protein binding transcription factor activity, this GO :0001102 : RNA polymerase II activating transcription factor binding, this GO :0003677 : DNA binding, this GO :0003682 : chromatin binding, this GO :0003690 : double-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0008013 : beta-catenin binding, this GO :0008134 : transcription factor binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, this GO :0019901 : protein kinase binding, this GO :0019902 : phosphatase binding, this GO :0030618 : transforming growth factor beta receptor, this GO :0031490 : chromatin DNA binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0035326 : enhancer binding, this GO :0042803 : protein homodimerization activity, this GO :0043130 : ubiquitin binding, this GO :0043425 : bHLH transcription factor binding, this GO :0043565 : sequence-specific DNA binding, this GO :0044212 : transcription regulatory region DNA binding, this GO :0046332 : SMAD binding, this GO :0070410 : co-SMAD binding, this GO :0070412 : R-SMAD binding, transforming growth factor beta receptor, SMAD family member 3
Identity: 6769
Gene: SMAD3 | More about : SMAD3
Long gene name: SMAD family member 3
Synonyms gene: MADH3
Synonyms gene name: MAD, mothers against DPP homolog 3 (Drosophila) , mothers against decapentaplegic homolog 3 (Drosophila) SMAD
Synonyms: JV15-2 HsT17436
Locus: 15q22, 33
Discovery year: 1996-11-15
GenBank acession: BC050743
Entrez gene record: 4088
Pubmed identfication: 8774881 8673135
RefSeq identity: NM_005902
Classification: SMAD family
Havana BLAST/BLAT: OTTHUMG00000133230
Locus Specific Databases: The Globin Gene Server

Related Products :

MBS619552 SMAD3 (Mothers Against Decapentaplegic Homolog 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, SMAD Family Member 3, SMAD 3, Smad3, JV15-2, MADH3) 50ug 928 € MBS Polyclonals_1 human
MBS621967 SMAD3 (Mothers Against Decapentaplegic Homolog 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, SMAD Family Member 3, SMAD 3, Smad3, JV15-2, MADH3) 50ug 630 € MBS Polyclonals_1 human
MBS624142 SMAD3, phosphorylated (Ser208) (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS611516 Smad2 (MADH2, JV18, MADR2, SMAD2, JV18-1, MAD, Mothers Against Decapentaplegic Homolog 2 (Drosophila), Mothers Against Decapentaplegic, Drosophila, Homolog of, 2, MAD (Mothers Against Decapentaplegic, Drosophila) Homolog 2) 100ug 591 € MBS Polyclonals_1 drosophila
CE17 Recombinant Human Mothers Against Decapentaplegic Homolog 3, SMAD3 (N-6His-Flag) 10 µg 141 € novo human
MBS623520 SMAD4, phosphorylated (Thr277) (Mothers Against Decapentaplegic Homolog 4, SMAD 4, Mothers Against DPP Homolog 4, Deletion Target In Pancreatic Carcinoma 4, MAD Homolog 4, SMAD Family Member 4, hSMAD4, DPC4, MADH4) Antibody 200ul 603 € MBS Polyclonals_1 human
CE08 Recombinant Human Mothers Against Decapentaplegic Homolog 2, SMAD2 (N-6His-Flag) 50 µg 303 € novo human
MBS621219 Smad2 (SMAD-2, hMAD-2, hSMAD2, JV18-1, JV18, MAD-related Protein 2, MADR2, MGC22139, MGC34440, Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MADH2) Antibody 100ug 735 € MBS Polyclonals_1 human
DL-Smad3-Hu Human Mothers Against Decapentaplegic Homolog 3 Smad3 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc10d96929 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc10e096c4 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc5dfa5855 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc5e00b7c2 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc9e439436 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd18e504c7 Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd65ad12fd Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd7cf8b4df Anti- Mothers Against Decapentaplegic Homolog 3 (Smad3) Antibody 100ug 564 € MBS Polyclonals human
EKU06005 Mothers Against Decapentaplegic Homolog 3 (Smad3) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
DL-Smad3-Mu Mouse Mothers Against Decapentaplegic Homolog 3 Smad3 ELISA Kit 96T 921 € DL elisas mouse
DL-Smad3-Ra Rat Mothers Against Decapentaplegic Homolog 3 Smad3 ELISA Kit 96T 962 € DL elisas rat
MBS617952 Smad3, phosphorylated (Ser423, Ser425) (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) 10 Blots 663 € MBS Polyclonals_1 human
MBS613728 Smad3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) 50ug 724 € MBS Polyclonals_1 human
MBS614753 Smad3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) 0.4 mg 591 € MBS Polyclonals_1 human
MBS621082 Smad3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) 100ug 464 € MBS Polyclonals_1 human
MBS612564 Smad3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) Antibody 100ug 641 € MBS Polyclonals_1 human
MBS622228 Smad3 (Small Mothers Against Decapentaplegic Deleted in Pancreatic Carcinoma) Antibody 100ug 464 € MBS Polyclonals_1 human
GWB-575B70 Recombinant Human Mothers Against Decapentaplegic Homolog 3 bulk Ask price € genways bulk human
abx260558 Anti-Mothers Against Decapentaplegic Homolog 3 Protein (Recombinant) 5 µg 238 € abbex human
abx260440 Anti-Mothers Against Decapentaplegic Homolog 4 Protein (Recombinant) 1 mg 2428 € abbex human
abx167113 Anti-Mothers Against Decapentaplegic Homolog 9 Protein (Recombinant) 10 μg 412 € abbex human