| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human GDP-L-Fucose Synthase is produced by our E, coli expression system and the target gene encoding Met1-Lys321 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 96 kD |
| UniProt number: |
Q13630 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARKLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
SDR4E1 (C-6His), TSTA3, GDP-L-Fucose Synthase |
| Short name: |
SDR4E1 (C-6His), TSTA3, Recombinant GDP-L-Fucose Synthase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
SDR4E1 (C-6His), sapiens GDP-L-Fucose Synthase, tissue specific transplantation antigen P35B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, FX and P35B and SDR4E1, TSTA3 and IDBG-38856 and ENSG00000104522 and 7264, TSTA3 and IDBG-643791 and ENSBTAG00000034691 and 513158, Tsta3 and IDBG-151936 and ENSMUSG00000022570 and 22122, coenzyme binding, this GO :0003824 and catalytic activity and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0016853 and isomerase activity and molecular function this GO :0019673 and GDP-mannose metabolic process and biological process this GO :0019835 and cytolysis and biological process this GO :0042351 and 'de novo' GDP-L-fucose biosynthetic process and biological process this GO :0042356 and GDP-4-dehydro-D-rhamnose reductase activity and molecular function this GO :0044237 and cellular metabolic process and biological process this GO :0050577 and GDP-L-fucose synthase activity and molecular function this GO :0050662 and coenzyme binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0009055 : electron carrier activity and also this GO :0016853 : isomerase activity and also this GO :0042356 : GDP-4-dehydro-D-rhamnose reductase activity and also this GO :0050577 : GDP-L-fucose synthase activity and also this GO :0050662 : coenzyme binding, this GO :0009055 : electron carrier activity, this GO :0016853 : isomerase activity, this GO :0042356 : GDP-4-dehydro-D-rhamnose reductase activity, this GO :0050577 : GDP-L-fucose synthase activity, this GO :0050662 : coenzyme binding, tissue specific transplantation antigen P35B |
| Identity: |
12390 |
| Gene: |
TSTA3 |
More about : TSTA3 |
| Long gene name: |
tissue specific transplantation antigen P35B |
| Synonyms: |
FX P35B SDR4E1 |
| Synonyms name: |
member 1 GDP-L-fucose synthase , short chain dehydrogenase/reductase family 4E |
| Locus: |
8q24, 3 |
| Discovery year: |
1998-03-20 |
| GenBank acession: |
U58766 |
| Entrez gene record: |
7264 |
| Pubmed identfication: |
7803801 1348494 19027726 |
| RefSeq identity: |
NM_003313 |
| Classification: |
Short chain dehydrogenase/reductase superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000165159 |