Recombinant Human Transcobalamin II Receptor, TCblR, 8D6A, CD320 (C-Fc)

Contact us
Catalog number: CD62
Price: 904 €
Supplier: DL elisas
Product name: Recombinant Human Transcobalamin II Receptor, TCblR, 8D6A, CD320 (C-Fc)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Transcobalamin II Receptor is produced by our Mammalian expression system and the target gene encoding Ser36-Val231 is expressed with a Fc tag at the C-terminus
Molecular Weight: 3 kD, 47
UniProt number: Q9NPF0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 8, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: 8D6A, CD320 (C-Fc), TCblR, Transcobalamin II Receptor
Short name: 8D6A, CD320 (C-Fc), TCblR, Recombinant Transcobalamin II Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 8D6A, CD320 molecule (C-fragment c), TCblR, sapiens Transcobalamin II Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: CD320 and IDBG-24538 and ENSG00000167775 and 51293, CD320 and IDBG-643810 and ENSBTAG00000004403 and 505043, Cd320 and IDBG-168060 and ENSMUSG00000002308 and 54219, Plasma membranes, cobalamin binding, this GO :0001558 and regulation of cell growth and biological process this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006766 and vitamin metabolic process and biological process this GO :0006767 and water-soluble vitamin metabolic process and biological process this GO :0008083 and growth factor activity and molecular function this GO :0009235 and cobalamin metabolic process and biological process this GO :0010008 and endosome membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031419 and cobalamin binding and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0031419 : cobalamin binding, this GO :0008083 : growth factor activity, this GO :0031419 : cobalamin binding, CD320 molecule
Identity: 16692
Gene: CD320 | More about : CD320
Long gene name: CD320 molecule
Synonyms gene name: CD320 antigen
Synonyms: 8D6 8D6A
Synonyms name: 8D6 antigen
Locus: 19p13, 2
Discovery year: 2005-02-09
GenBank acession: AF161254
Entrez gene record: 51293
Pubmed identfication: 10727470
RefSeq identity: NM_016579
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000182457

Related Products :

MBS620492 CD320 (CD320 molecule, 8D6, 8D6A, 8D6 antigen, CD320 antigen, FDC-signaling molecule 8D6, FDC-SM-8D6, TCblR, Transcobalamin receptor, UNQ198/PRO224) 100ug 774 € MBS Polyclonals_1 human
MBS620003 CD320 (CD320 molecule, 8D6, 8D6A, 8D6 antigen, CD320 antigen, FDC-signaling molecule 8D6, FDC-SM-8D6, TCblR, Transcobalamin receptor, UNQ198/PRO224) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
CC01 Recombinant Human Transcobalamin II Receptor, TCblR, 8D6A, CD320 (C-6His) 50 µg 303 € novo human
CD62 Recombinant Human Transcobalamin II Receptor, TCblR, 8D6A, CD320 (C-Fc) 10 µg 146 € novo human
MBS619440 Transcobalamin 1 (Transcobalamin-1, TC1, TC-1, TCN1, Transcobalamin I, Transcobalamin-I, TC I, TCI, TC-I, Haptocorin, Haptocorrin, Vitamin B12 Binding Protein R Binder Family) 50ug 669 € MBS Polyclonals_1 human
abx250221 Anti-Human CD320/8D6A ELISA Kit 96 tests 586 € abbex human
GENTAUR-58b8dce6c7f3e Bovine CD320 antigen (CD320) 100ug 1558 € MBS Recombinant Proteins bovine
GENTAUR-58b8dce7269d7 Bovine CD320 antigen (CD320) 1000ug 1558 € MBS Recombinant Proteins bovine
GENTAUR-58b8dce75ec4a Bovine CD320 antigen (CD320) 100ug 2061 € MBS Recombinant Proteins bovine
GENTAUR-58b8dce7cf4a7 Bovine CD320 antigen (CD320) 1000ug 2061 € MBS Recombinant Proteins bovine
GENTAUR-58b9d8e39d4eb Bovine CD320 antigen (CD320) 100ug 1558 € MBS Recombinant Proteins bovine
GENTAUR-58b9d8e3dde2f Bovine CD320 antigen (CD320) 1000ug 1558 € MBS Recombinant Proteins bovine
GENTAUR-58b9d8e431548 Bovine CD320 antigen (CD320) 100ug 2061 € MBS Recombinant Proteins bovine
GENTAUR-58b9d8e4775cc Bovine CD320 antigen (CD320) 1000ug 2061 € MBS Recombinant Proteins bovine
RP-1485H Recombinant Human TCN2 / Transcobalamin-II Protein (His Tag) 20μg 456 € adv human
abx167015 Anti-Transcobalamin I Protein (Recombinant) 100 μg 862 € abbex human
abx166803 Anti-Transcobalamin II, Macrocytic Anemia Protein (Recombinant) 100 μg 833 € abbex human
RP-1539M Recombinant Mouse TCN2 / Transcobalamin-II Protein (His Tag) 10μg 624 € adv mouse
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CEK1099 anti-Human CD320 ELISA Kit Antibody 96 Tests 703 € acr human
LV113181 CD320 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV113182 CD320 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV113183 CD320 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV113184 CD320 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV113186 CD320 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV113185 CD320 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx250742 Anti-Human Transcobalamin-2 ELISA Kit 96 tests 659 € abbex human
abx153374 Anti-Human Transcobalamin I ELISA Kit inquire 50 € abbex human
abx574858 Anti-Human Transcobalamin I (TCN1) ELISA Kit 96 tests 789 € abbex human
DL-TCN1-Hu Human Transcobalamin I TCN1 ELISA Kit 96T 904 € DL elisas human