| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Transcobalamin II Receptor is produced by our Mammalian expression system and the target gene encoding Ser36-Val231 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
3 kD, 47 |
| UniProt number: |
Q9NPF0 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 8, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
8D6A, CD320 (C-Fc), TCblR, Transcobalamin II Receptor |
| Short name: |
8D6A, CD320 (C-Fc), TCblR, Recombinant Transcobalamin II Receptor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
8D6A, CD320 molecule (C-fragment c), TCblR, sapiens Transcobalamin II Receptor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD320 and IDBG-24538 and ENSG00000167775 and 51293, CD320 and IDBG-643810 and ENSBTAG00000004403 and 505043, Cd320 and IDBG-168060 and ENSMUSG00000002308 and 54219, Plasma membranes, cobalamin binding, this GO :0001558 and regulation of cell growth and biological process this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006766 and vitamin metabolic process and biological process this GO :0006767 and water-soluble vitamin metabolic process and biological process this GO :0008083 and growth factor activity and molecular function this GO :0009235 and cobalamin metabolic process and biological process this GO :0010008 and endosome membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031419 and cobalamin binding and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0031419 : cobalamin binding, this GO :0008083 : growth factor activity, this GO :0031419 : cobalamin binding, CD320 molecule |
| Identity: |
16692 |
| Gene: |
CD320 |
More about : CD320 |
| Long gene name: |
CD320 molecule |
| Synonyms gene name: |
CD320 antigen |
| Synonyms: |
8D6 8D6A |
| Synonyms name: |
8D6 antigen |
| Locus: |
19p13, 2 |
| Discovery year: |
2005-02-09 |
| GenBank acession: |
AF161254 |
| Entrez gene record: |
51293 |
| Pubmed identfication: |
10727470 |
| RefSeq identity: |
NM_016579 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000182457 |