| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ER resident protein 44 is produced by our Mammalian expression system and the target gene encoding Glu30-Asp402 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 44 |
| UniProt number: |
Q9BS26 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM Tris HCl，10%glycerol, 5, PH7, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ERp44, TXNDC4 (C-6His), ER Resident Protein 44 |
| Short name: |
ERp44, TXNDC4 (C-6His), Recombinant ER Resident Protein 44 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ERp44, TXNDC4 (C-6His), sapiens ER Resident Protein 44, recombinant H |
| Alternative technique: |
rec |
| Identity: |
18311 |
| Gene: |
ERP44 |
More about : ERP44 |
| Long gene name: |
endoplasmic reticulum protein 44 |
| Synonyms gene: |
TXNDC4 |
| Synonyms gene name: |
thioredoxin domain containing 4 (endoplasmic reticulum) |
| Synonyms: |
KIAA0573 PDIA10 |
| Synonyms name: |
member 10 , protein disulfide isomerase family A |
| Locus: |
9q31, 1 |
| Discovery year: |
2002-11-11 |
| GenBank acession: |
AB011145 |
| Entrez gene record: |
23071 |
| Pubmed identfication: |
11847130 |
| RefSeq identity: |
XM_088476 |
| Classification: |
Protein disulfide isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000020363 |