| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human alpha-lactalbumin is produced by our Mammalian expression system and the target gene encoding Lys20-Leu142 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 15 |
| UniProt number: |
P00709 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, PH8, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LALBA (C-6His), &alpha, -Lactalbumin |
| Short name: |
LALBA (C-6His), -Lactalbumin, Recombinant &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
alpha- (C-6His), lactalbumin, sapiens &alpha, -Lactalbumin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, LALBA and IDBG-30143 and ENSG00000167531 and 3906, LALBA and IDBG-632851 and ENSBTAG00000005859 and 281894, Lalba and IDBG-180342 and ENSMUSG00000022991 and 16770, alpha-, protein binding, this GO :0004461 and lactose synthase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005989 and lactose biosynthetic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0042742 and defense response to bacterium and biological process, this GO :0004461 : lactose synthase activity, this GO :0004461 : lactose synthase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, lactalbumin |
| Identity: |
6480 |
| Gene: |
LALBA |
More about : LALBA |
| Long gene name: |
lactalbumin alpha |
| Synonyms gene name: |
alpha- , lactalbumin |
| Synonyms: |
LYZL7 |
| Locus: |
12q13, 11 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
3906 |
| RefSeq identity: |
NM_002289 |
| Classification: |
Lysozymes, c-type |
| Havana BLAST/BLAT: |
OTTHUMG00000170391 |