Recombinant Human α-Lactalbumin, LALBA (C-6His)

Contact us
Catalog number: CD49
Price: 1216 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human α-Lactalbumin, LALBA (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human alpha-lactalbumin is produced by our Mammalian expression system and the target gene encoding Lys20-Leu142 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 15
UniProt number: P00709
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, PH8, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LALBA (C-6His), &alpha, -Lactalbumin
Short name: LALBA (C-6His), -Lactalbumin, Recombinant &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: alpha- (C-6His), lactalbumin, sapiens &alpha, -Lactalbumin, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, LALBA and IDBG-30143 and ENSG00000167531 and 3906, LALBA and IDBG-632851 and ENSBTAG00000005859 and 281894, Lalba and IDBG-180342 and ENSMUSG00000022991 and 16770, alpha-, protein binding, this GO :0004461 and lactose synthase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005989 and lactose biosynthetic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0042742 and defense response to bacterium and biological process, this GO :0004461 : lactose synthase activity, this GO :0004461 : lactose synthase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, lactalbumin
Identity: 6480
Gene: LALBA | More about : LALBA
Long gene name: lactalbumin alpha
Synonyms gene name: alpha- , lactalbumin
Synonyms: LYZL7
Locus: 12q13, 11
Discovery year: 2001-06-22
Entrez gene record: 3906
RefSeq identity: NM_002289
Classification: Lysozymes, c-type
Havana BLAST/BLAT: OTTHUMG00000170391

Related Products :

CD49 Recombinant Human α-Lactalbumin, LALBA (C-6His) 50 µg 496 € novo human
GENTAUR-58be5ac866ea0 Anti-LALBA/alpha Lactalbumin, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
AE36056CA Cat Alpha-lactalbumin (LALBA) ELISA Kit 48 wells plate 500 € ab-elisa elisas cat
AE36056CA-96 Cat Alpha-lactalbumin (LALBA) ELISA Kit 1x plate of 96 wells 671 € abebio cat
AE58424DK Donkey Alpha-lactalbumin (LALBA) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE58424DK-96 Donkey Alpha-lactalbumin (LALBA) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE36056CA-48 ELISA test for Cat Alpha-lactalbumin (LALBA) 1x plate of 48 wells 402 € abebio cat
AE58424DK-48 ELISA test for Donkey Alpha-lactalbumin (LALBA) 1x plate of 48 wells 402 € abebio human
AE36054GO-48 ELISA test for Goat Alpha-lactalbumin (LALBA) 1x plate of 48 wells 402 € abebio human
AE36053GU-48 ELISA test for Guinea pig Alpha-lactalbumin (LALBA) 1x plate of 48 wells 402 € abebio human
AE36049RB-48 ELISA test for Rabbit Alpha-lactalbumin (LALBA) 1x plate of 48 wells 402 € abebio human
AE36054GO Goat Alpha-lactalbumin (LALBA) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE36054GO-96 Goat Alpha-lactalbumin (LALBA) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE36053GU Guinea pig Alpha-lactalbumin (LALBA) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE36053GU-96 Guinea pig Alpha-lactalbumin (LALBA) ELISA Kit 1x plate of 96 wells 671 € abebio human
bs-11131R-A350 LALBA/alpha Lactalbumin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11131R-A488 LALBA/alpha Lactalbumin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11131R-A555 LALBA/alpha Lactalbumin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11131R-A594 LALBA/alpha Lactalbumin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11131R-A647 LALBA/alpha Lactalbumin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11131R-Biotin LALBA/alpha Lactalbumin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11131R LALBA/alpha Lactalbumin Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11131R-Cy3 LALBA/alpha Lactalbumin Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11131R-Cy5 LALBA/alpha Lactalbumin Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11131R-Cy5.5 LALBA/alpha Lactalbumin Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11131R-Cy7 LALBA/alpha Lactalbumin Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11131R-FITC LALBA/alpha Lactalbumin Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11131R-HRP LALBA/alpha Lactalbumin Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58b8dded8169d Macropus giganteus Alpha-lactalbumin I (LALBA) 100ug 1216 € MBS Recombinant Proteins human
GENTAUR-58b8ddedd7461 Macropus giganteus Alpha-lactalbumin I (LALBA) 1000ug 1216 € MBS Recombinant Proteins human