Recombinant Human CD83, HB15 (C-Fc)

Contact us
Catalog number: CD40
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human CD83, HB15 (C-Fc)
Quantity: vial
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a Fc tag at the C-terminus
Molecular Weight: 2 kD, 41
UniProt number: Q01151
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HB15 (C-Fc), CD83
Short name: HB15 (C-Fc), Recombinant CD83
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HB15 (C-fragment c), sapiens CD83 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, Cell surfaces, alpha-beta T cell differentiation and biological process, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0014070 and response to organic cyclic compound and biological process this GO :0032713 and negative regulation of interleukin-4 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0043372 and positive regulation of CD4-positive, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD83 molecule
Identity: 1703
Gene: CD83 | More about : CD83
Long gene name: CD83 molecule
Synonyms gene name: CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule
Synonyms: HB15 BL11
Locus: 6p23
Discovery year: 1999-03-26
GenBank acession: Z11697
Entrez gene record: 9308
Pubmed identfication: 1378080 8422464
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000014283

Related Products :

C403 Recombinant Human CD83, HB15 (C-6His) 50 µg 273 € novo human
CD40 Recombinant Human CD83, HB15 (C-Fc) 1 mg 2283 € novo human
RP-0369H Recombinant Human CD83 / HB15 Protein (His Tag) 50μg 624 € adv human
CM53 Recombinant Mouse CD83, HB15 (C-6His) 50 µg 232 € novo mouse
CM01 Recombinant Mouse CD83, HB15 (C-Fc) 500 µg 1328 € novo mouse
RP-1166M Recombinant Mouse CD83 / HB15 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1165M Recombinant Mouse CD83 / HB15 Protein (His Tag) 50μg 624 € adv mouse
GENTAUR-58bcd9a926e01 Mouse CD83 antigen (Cd83) 100ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a97f34e Mouse CD83 antigen (Cd83) 1000ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a9bc745 Mouse CD83 antigen (Cd83) 100ug 1901 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9aa11b08 Mouse CD83 antigen (Cd83) 1000ug 1901 € MBS Recombinant Proteins mouse
abx262450 Anti-CD83 Protein (Recombinant) 10 µg 340 € abbex human
RP-1057RC Recombinant Cynomolgus CD83 Protein (Fc Tag) 50μg 624 € adv human
RP-2075R Recombinant Rat CD83 Protein (Fc Tag) 50μg 624 € adv rat
RP-2076R Recombinant Rat CD83 Protein (His Tag) 50μg 624 € adv rat
101-M316 Anti-Human CD83 100ug 336 € Reliatech antibodies human
abx151006 Anti-Human CD83 ELISA Kit 96 tests 891 € abbex human
abx575613 Anti-Human CD83 ELISA Kit inquire 50 € abbex human
GWB-PPST13 CD83, 20-144aa Human, His tag, E.coli bulk Ask price € genways bulk human
MEDCLA898-01 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 0.1000ul 428 € accurate-monoclonals human
MEDCLA898-1 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 1000ul 1081 € accurate-monoclonals human
YSRTMCA1582GA CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582T CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 20 ug Ask price € accurate-monoclonals human
YSRTMCA1582B CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, Biotin 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582BT CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, Biotin 25 ug Ask price € accurate-monoclonals human
YSRTMCA1582F CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, FITC 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582FT CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, FITC 25 ug Ask price € accurate-monoclonals human
YSRTMCA1582 CD83, Clone: HB15A, Mouse Monoclonal antibody-Human; frozen, IH/flow/IP 200ug Ask price € accurate-monoclonals human
YSRTMCA1582PE CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, RPE vial Ask price € accurate-monoclonals human
YSRTMCA1582PET CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, RPE vial Ask price € accurate-monoclonals human