| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TWEAK Receptor is produced by our Mammalian expression system and the target gene encoding Glu28-Trp79 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
35, 6 kD |
| UniProt number: |
Q9NP84 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TNFRSF12A (C-Fc), TWEAK R, TWEAK Receptor |
| Short name: |
TNFRSF12A (C-Fc), TWEAK R, Recombinant TWEAK Receptor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
TWEAK R, member 12A (C-fragment c), sapiens TWEAK Receptor, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Cell surfaces, TNFRSF12A and IDBG-11328 and ENSG00000006327 and 51330, Tnfrsf12a and IDBG-143687 and ENSMUSG00000023905 and 27279, cell attachment to substrate and biological process this GO :0007155 and cell adhesion and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045773 and positive regulation of axon extension and biological process this GO :0061041 and regulation of wound healing and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, member 12A, protein binding, this GO :0001525 and angiogenesis and biological process this GO :0001726 and ruffle and cellular component this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006931 and substrate-dependent cell migration, this GO :0005515 : protein binding, this GO :0005515 : protein binding, 20111 and IDBG-635818 and ENSBTAG00000012082 and 617439, tumor necrosis factor receptor superfamily |
| Identity: |
18152 |
| Gene: |
TNFRSF12A |
More about : TNFRSF12A |
| Long gene name: |
TNF receptor superfamily member 12A |
| Synonyms gene name: |
member 12A , tumor necrosis factor receptor superfamily |
| Synonyms: |
FN14 TweakR CD266 |
| Locus: |
16p13, 3 |
| Discovery year: |
2002-12-20 |
| GenBank acession: |
AB035480 |
| Pubmed identfication: |
10751351 10551889 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000129001 |