Recombinant Human Growth Hormone-Releasing Factor, GHRF, Somatoliberin (C-Fc)

Contact us
Catalog number: CD19
Price: 602 €
Supplier: genways
Product name: Recombinant Human Growth Hormone-Releasing Factor, GHRF, Somatoliberin (C-Fc)
Quantity: 1 vial
Other quantities: 10 µg 70€ 500 µg 151€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are  , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules 
Molecular Weight: 33, 4 kD
UniProt number: P01286
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GHRF, Somatoliberin (C-Fc), Growth Hormone-Releasing Factor
Short name: GHRF, Somatoliberin (C-Fc), Recombinant Growth Hormone-Releasing Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GHRF, Somatoliberin (C-fragment c), sapiens Growth Hormone-Releasing Factor, recombinant H
Alternative technique: rec
Identity: 4265
Gene: GHRH | More about : GHRH
Long gene name: growth hormone releasing hormone
Synonyms gene: GHRF
Synonyms name: sermorelin somatocrinin somatoliberin
Locus: 20q11, 23
Discovery year: 1986-01-01
Entrez gene record: 2691
Pubmed identfication: 3918305
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000032413

Related Products :

MBS620666 Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin) 1 mililiter 531 € MBS Polyclonals_1 human
CD19 Recombinant Human Growth Hormone-Releasing Factor, GHRF, Somatoliberin (C-Fc) 1 mg 456 € novo human
MBS612749 Gonadotropin-releasing Hormone Receptor (GNRHR, GNRHR1, GRHR, LHRHR, LRHR, Gonadotropin-releasing hormone (type 1) receptor 1, Luteinizing hormone releasing hormone receptor, Leutinizing-releasing hormone receptor, Luliberin receptor, type I GnRH receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619234 Growth Hormone Releasing Factor (GHRF, GHRH) Antibody 1000ug 685 € MBS Polyclonals_1 human
AP05972SU-N anti-GHRF / GHRH / Somatoliberin Antibody 1 ml 442 € acr human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS620069 CRHR1, aa107-117 (Corticotropin releasing hormone receptor 1, CRF-R, CRF1, CRH-R1h, CRHR, CRHR1f, corticotropin releasing hormone receptor variant 1h, seven transmembrane helix receptor) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS619813 Thyrotropin-releasing Hormone Receptor, CT (Thyrotropin Releasing Hormone Receptor, TRH Receptor, TRHR, TRH-R, MGC141920, Thyroliberin Receptor) 50ug 928 € MBS Polyclonals_1 human
MBS622177 Ghrelin (Ghrl, Growth hormone secretagogue, Growth-hormone releasing protein, Motilin-related peptide, M46 protein, Mtlrp, MTLRPAP, Appetite-regulating hormone) Antibody 0.05 ml 652 € MBS Polyclonals_1 human
abx253864 Anti-Human Growth Hormone Releasing Hormone ELISA Kit inquire 50 € abbex human
RP-1473 Human Growth Hormone Releasing Hormone 250 μg 188 € adi human
DL-GHRH-Hu Human Growth Hormone Releasing Hormone GHRH ELISA Kit 96T 846 € DL elisas human
MBS235398 SHEEP ANTI HUMAN GROWTH HORMONE RELEASING HORMONE Antibody 1 mililiter 376 € MBS Polyclonals_1 human
MBS620141 Corticoliberin, Pro (Pro-Corticoliberin, Pro-CRF, Pro-CRH, Pro Corticotropin releasing hormone, Pro Corticotropin-releasing factor) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS624558 CRHR2, NT (Corticotropin-releasing Factor Receptor 2, CRF-R 2, CRF2, Corticotropin-releasing Hormone Receptor 2, CRH-R 2, CRH2R, CRF2R) Antibody 200ul 603 € MBS Polyclonals_1 human
abx261835 Anti-Growth Hormone Releasing Hormone 5 mg 673 € abbex human
GENTAUR-58bdc1587baaf Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc158e1442 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc5ff840df Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdcca304f59 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdcf2996255 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf2a2ac52 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd6a328150 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddd3d0c838 Anti- Growth Hormone Releasing Hormone (GHRH) Antibody 100ug 531 € MBS Polyclonals human
abx254745 Anti-Mouse Growth Hormone Releasing Hormone ELISA Kit inquire 50 € abbex mouse
abx255479 Anti-Pig Growth Hormone Releasing Hormone ELISA Kit 96 tests 557 € abbex pig
abx256281 Anti-Rat Growth Hormone Releasing Hormone ELISA Kit inquire 50 € abbex rat
GWB-5793C9 antibody to or anti- Growth hormone-releasing hormone receptor form a antibody 1 x 1 vial 602 € genways human
GWB-950810 antibody to or anti- Growth hormone-releasing hormone receptor form a antibody 1 vial 602 € genways human
GWB-FCB28B antibody to or anti- Growth hormone-releasing hormone receptor form a antibody 1 vial 602 € genways human