| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human GDNF is produced by our Mammalian expression system and the target gene encoding Phe20-Ile211 is expressed with a Fc |
| Molecular Weight: |
49, 6 kD |
| UniProt number: |
P39905 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
GDNF (C-Fc-6His), Glial Line-Derived Neurotrophic Factor |
| Short name: |
GDNF (C-Fc-6His), Recombinant Glial Cell Line-Derived Neurotrophic Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
glial cell derived neurotrophic factor (C-fragment c-6His), sapiens Glial cellular Line-Derived Neurotrophic Factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ATF1 and ATF2 and HFB1-GDNF and HSCR3, BT, Extracellular, GDNF and IDBG-17169 and ENSG00000168621 and 2668, Gdnf and IDBG-128378 and ENSMUSG00000022144 and 14573, protein homodimerization activity, this GO :0001656 and metanephros development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001759 and organ induction and biological process this GO :0001941 and postsynaptic membrane organization and biological process this GO :0003337 and mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0021784 and postganglionic parasympathetic nervous system development and biological process this GO :0030432 and peristalsis and biological process this GO :0031175 and neuron projection development and biological process this GO :0032770 and positive regulation of monooxygenase activity and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048255 and mRNA stabilization and biological process this GO :0048484 and enteric nervous system development and biological process this GO :0048485 and sympathetic nervous system development and biological process this GO :0051584 and regulation of dopamine uptake involved in synaptic transmission and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060688 and regulation of morphogenesis of a branching structure and biological process this GO :0072107 and positive regulation of ureteric bud formation and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, 58072 and IDBG-630047 and ENSBTAG00000005176 and 386587, glial cell derived neurotrophic factor |
| Identity: |
4232 |
| Gene: |
GDNF |
More about : GDNF |
| Long gene name: |
glial cell derived neurotrophic factor |
| Synonyms: |
ATF1 ATF2 HFB1-GDNF |
| Synonyms name: |
astrocyte-derived trophic factor glial cell line derived neurotrophic factor glial derived neurotrophic factor |
| Locus: |
5p13, 2 |
| Discovery year: |
1995-05-04 |
| Entrez gene record: |
2668 |
| Pubmed identfication: |
8493557 |
| RefSeq identity: |
NM_000514 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000090809 |