Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His)

Contact us
Catalog number: CD08
Price: 846 €
Supplier: DL elisas
Product name: Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human GDNF is produced by our Mammalian expression system and the target gene encoding Phe20-Ile211 is expressed with a Fc
Molecular Weight: 49, 6 kD
UniProt number: P39905
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GDNF (C-Fc-6His), Glial Line-Derived Neurotrophic Factor
Short name: GDNF (C-Fc-6His), Recombinant Glial Cell Line-Derived Neurotrophic Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: glial cell derived neurotrophic factor (C-fragment c-6His), sapiens Glial cellular Line-Derived Neurotrophic Factor, recombinant H
Alternative technique: rec
Alternative to gene target: ATF1 and ATF2 and HFB1-GDNF and HSCR3, BT, Extracellular, GDNF and IDBG-17169 and ENSG00000168621 and 2668, Gdnf and IDBG-128378 and ENSMUSG00000022144 and 14573, protein homodimerization activity, this GO :0001656 and metanephros development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001759 and organ induction and biological process this GO :0001941 and postsynaptic membrane organization and biological process this GO :0003337 and mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0021784 and postganglionic parasympathetic nervous system development and biological process this GO :0030432 and peristalsis and biological process this GO :0031175 and neuron projection development and biological process this GO :0032770 and positive regulation of monooxygenase activity and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048255 and mRNA stabilization and biological process this GO :0048484 and enteric nervous system development and biological process this GO :0048485 and sympathetic nervous system development and biological process this GO :0051584 and regulation of dopamine uptake involved in synaptic transmission and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060688 and regulation of morphogenesis of a branching structure and biological process this GO :0072107 and positive regulation of ureteric bud formation and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, 58072 and IDBG-630047 and ENSBTAG00000005176 and 386587, glial cell derived neurotrophic factor
Identity: 4232
Gene: GDNF | More about : GDNF
Long gene name: glial cell derived neurotrophic factor
Synonyms: ATF1 ATF2 HFB1-GDNF
Synonyms name: astrocyte-derived trophic factor glial cell line derived neurotrophic factor glial derived neurotrophic factor
Locus: 5p13, 2
Discovery year: 1995-05-04
Entrez gene record: 2668
Pubmed identfication: 8493557
RefSeq identity: NM_000514
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000090809

Related Products :

MBS612853 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 100ul 652 € MBS Polyclonals_1 human
MBS613517 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) 50ug 652 € MBS Polyclonals_1 human
MBS618177 Glial Derived Neurotrophic Factor (GDNF, Glial cell line-derived neurotrophic factor, Astrocyte-derived trophic factor 1, ATF-1, ATF-2) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS622722 GFR alpha1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1, GDNF Family Receptor alpha 1, GDNF Receptor alpha 1, GFR-alpha-1, GFRalpha1, GFRA1, GDNF Receptor alpha, GDNFR alpha, GDNFR-alpha, GDNFRa, GDNFR, GPI-linked Anchor Protein, MGC23045 Antibody 100ug 857 € MBS Polyclonals_1 human
CD08 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His) 10 µg 156 € novo human
C226 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF 1 mg 2283 € novo human
AE42365HU-48 ELISA test for Human Glial cell line-derived neurotrophic factor (GDNF) 1x plate of 48 wells 373 € abebio human
AE42365HU Human Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE42365HU-96 Human Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-GDNF-Hu Human Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc86634507 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdc9f7bea45 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc9f99e94a Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdcb70c74ec Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdce0e2ea73 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdce0e8efa2 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd50933bc6 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdda3d59311 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdda78f3690 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bddaecdc995 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bddaed3837c Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bddd04e4b36 Anti- Glial Cell Line Derived Neurotrophic Factor (GDNF) Antibody 100ug 553 € MBS Polyclonals human
AE42364MO-48 ELISA test for Mouse Glial cell line-derived neurotrophic factor (GDNF) 1x plate of 48 wells 360 € abebio mouse
EKU04375 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
EKU04376 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU04377 Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA kit 1 plate of 96 wells 720 € Biomatik ELISA kits human
AE42364MO Mouse Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 48 wells plate 465 € ab-elisa elisas mouse
AE42364MO-96 Mouse Glial cell line-derived neurotrophic factor (GDNF) ELISA Kit 1x plate of 96 wells 587 € abebio mouse
DL-GDNF-Mu Mouse Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 869 € DL elisas mouse
DL-GDNF-Ra Rat Glial Cell Line Derived Neurotrophic Factor GDNF ELISA Kit 96T 846 € DL elisas rat