Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His)

Contact us
Catalog number: CC83
Price: 463 €
Supplier: genways
Product name: Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His)
Quantity: 1 x 1 vial
Other quantities: 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LILRA3 is produced by our Mammalian expression system and the target gene encoding Thr19-Glu439 is expressed with a 6His tag at the C-terminus
Molecular Weight: 46, 6 kD
UniProt number: Q8N6C8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD85e (C-6His), ILT6, LILRA3, Leukocyte Ig-Like Receptor A3
Short name: CD85e (C-6His), ILT6, LILRA3, Recombinant Leukocyte Ig-Like Receptor A3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD85e (C-6His), ILT6, LILRA3, sapiens Leukocyte Ig-Like Receptor A3, recombinant H
Alternative technique: rec
Identity: 6604
Gene: LILRA3 | More about : LILRA3
Long gene name: leukocyte immunoglobulin like receptor A3
Synonyms gene name: leukocyte immunoglobulin-like receptor, member 3 , subfamily A (without TM domain)
Synonyms: LIR-4 HM43 ILT6 HM31 LIR4 CD85e
Synonyms name: leucocyte Ig-like receptor A3
Locus: 19q13, 4 alternate reference locus
Discovery year: 2000-01-11
GenBank acession: U91926
Entrez gene record: 11026
Pubmed identfication: 9278324 9548455
Classification: Activating leukocyte immunoglobulin like receptors CD molecules

Related Products :

CC83 Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His) 10 µg 146 € novo human
RP-0927H Recombinant Human ILT6 / LILRA3 Protein (Fc Tag) 20μg 572 € adv human
RP-0926H Recombinant Human ILT6 / LILRA3 Protein (His Tag) 20μg 572 € adv human
DL-LILRA3-Hu Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 LILRA3 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdd775a3c5b Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd973dd40e Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddae7511c8 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bddae7b4d89 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) Antibody 100ug 470 € MBS Polyclonals human
EKU05627 Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
CA47 Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His) 50 µg 369 € novo human
C484 Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His) 500 µg 1613 € novo human
C485 Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His) 10 µg 121 € novo human
C574 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-6His) 50 µg 303 € novo human
CD41 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-Fc-6His) 10 µg 146 € novo human
C443 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-6His) 50 µg 273 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
abx152200 Anti-Human LILRA3 ELISA Kit 96 tests 891 € abbex human
abx572578 Anti-Human LILRA3 ELISA Kit 96 tests 760 € abbex human
LV205343 LILRA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV205344 LILRA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV205345 LILRA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205346 LILRA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205348 LILRA3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV205347 LILRA3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
RP-879 Recombinant (E.Coli) Human Leukocyte-Associated Ig-Like Receptor 1 5 μg 188 € adi human
CD16 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-Fc) 50 µg 303 € novo human
abx922555 Anti-LILRA3 siRNA inquire 50 € abbex human
GWB-MX330F LILRA3 antibody 1 vial 521 € genways human
GWB-3B8697 LILRA3 Over-expression Lysate reagent 1 x 1 vial 463 € genways human