Recombinant Human Regenerating Islet-Derived Protein 3-γ, Reg3γ, REG3G (C-6His)

Contact us
Catalog number: CC77
Price: 470 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Regenerating Islet-Derived Protein 3-γ, Reg3γ, REG3G (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 5 kD
UniProt number: Q6UW15
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: REG3G (C-6His), Reg3&gamma, Regenerating Islet-Derived Protein 3-&gamma
Short name: REG3G (C-6His), Reg3&gamma, Recombinant Regenerating Islet-Derived Protein 3-&gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: Reg3&gamma, regenerating islet-derived 3 g (C-6His), sapiens Regenerating Islet-Derived Protein 3-&gamma, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, REG3G and IDBG-58387 and ENSG00000143954 and 130120, carbohydrate binding, this GO :0002755 and MyD88-dependent toll-like receptor signaling pathway and biological process this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006953 and acute-phase response and biological process this GO :0010838 and positive regulation of keratinocyte proliferation and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0045617 and negative regulation of keratinocyte differentiation and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0090303 and positive regulation of wound healing and biological process, this GO :0030246 : carbohydrate binding, this GO :0030246 : carbohydrate binding, regenerating islet-derived 3 gamma
Identity: 29595
Gene: REG3G | More about : REG3G
Long gene name: regenerating family member 3 gamma
Synonyms gene name: regenerating islet-derived 3 gamma
Synonyms: UNQ429 LPPM429 PAP1B
Locus: 2p12
Discovery year: 2005-02-11
GenBank acession: AY359047
Entrez gene record: 130120
Pubmed identfication: 12975309
RefSeq identity: NM_198448
Classification: C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000130018

Related Products :

CC77 Recombinant Human Regenerating Islet-Derived Protein 3-γ, Reg3γ, REG3G (C-6His) 10 µg 202 € novo human
E-EL-Ch0123 Chicken REG3γ (Regenerating Islet Derived Protein 3 Gamma) ELISA Kit 96T 568 € elabsciences human
DL-REG3g-Hu Human Regenerating Islet Derived Protein 3 Gamma REG3g ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc29deff7b Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc29e50b2c Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdca1064e9f Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdca10c69e1 Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb07b6997 Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd1c368a50 Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd5e50fd83 Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd6d540bdf Anti- Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bc5698c06fd Mouse Regenerating islet-derived protein 3-gamma (Reg3g) 100ug 1492 € MBS Recombinant Proteins mouse
GENTAUR-58bc56991678a Mouse Regenerating islet-derived protein 3-gamma (Reg3g) 1000ug 1492 € MBS Recombinant Proteins mouse
GENTAUR-58bc56995138e Mouse Regenerating islet-derived protein 3-gamma (Reg3g) 100ug 1995 € MBS Recombinant Proteins mouse
GENTAUR-58bc5699e637f Mouse Regenerating islet-derived protein 3-gamma (Reg3g) 1000ug 1995 € MBS Recombinant Proteins mouse
DL-REG3g-Mu Mouse Regenerating Islet Derived Protein 3 Gamma REG3g ELISA Kit 96T 921 € DL elisas mouse
EKU07047 Regenerating Islet Derived Protein 3 Gamma (REG3g) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU07048 Regenerating Islet Derived Protein 3 Gamma (REG3g) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
C530 Recombinant Human Regenerating Islet-Derived Protein 1-α, REG1A (C-6His) 1 mg 2283 € novo human
CD30 Recombinant Human Regenerating Islet-Derived Protein 4, RELP (C-6His) 50 µg 303 € novo human
RP-872 Recombinant (E.Coli, His-tag) Human Regenerating islet-derived protein 4 10 μg 333 € adi human
AE22529HU-48 ELISA test for Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) 1x plate of 48 wells 402 € abebio human
AE22529HU Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE22529HU-96 Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-REG1a-Hu Human Regenerating Islet Derived Protein 1 Alpha REG1a ELISA Kit 96T 869 € DL elisas human
DL-REG1b-Hu Human Regenerating Islet Derived Protein 1 Beta REG1b ELISA Kit 96T 904 € DL elisas human
DL-REG3a-Hu Human Regenerating Islet Derived Protein 3 Alpha REG3a ELISA Kit 96T 904 € DL elisas human
DL-REG4-Hu Human Regenerating Islet Derived Protein 4 REG4 ELISA Kit 96T 869 € DL elisas human
MBS242962 Anti-Human REG1 / Regenerating Islet-Derived 1 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdc18394a2d Anti- Regenerating Islet Derived Protein 1 Alpha (REG1a) Antibody 100ug 470 € MBS Polyclonals human