Recombinant Human Transforming Growth Factor Receptor Type II, TGFBR2 (C-Fc)

Contact us
Catalog number: CC10
Price: 531 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Transforming Growth Factor Receptor Type II, TGFBR2 (C-Fc)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Thr23-Asp159 is expressed with a Fc tag at the C-terminus
Molecular Weight: 42, 6 kD
UniProt number: P37173
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TGFBR2 (C-Fc), Transforming Growth Factor Receptor II
Short name: TGFBR2 (C-Fc), Recombinant Transforming Growth Factor Receptor II
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: b receptor II (70/80kDa) (C-fragment c), sapiens Transforming Growth Factor Receptor classification II, transforming growth factor, recombinant H
Alternative technique: rec
Alternative to gene target: AAT3 and FAA3 and LDS1B and LDS2 and LDS2B and MFS2 and RIIC and TAAD2 and TGFbeta-RII and TGFR-2, BT, Cell surfaces, TGFBR2 and IDBG-23359 and ENSG00000163513 and 7048, Tgfbr2 and IDBG-203902 and ENSMUSG00000032440 and 21813, beta receptor II (70/80kDa), this GO :0001568 and blood vessel development and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002053 and positive regulation of mesenchymal cell proliferation and biological process this GO :0002088 and lens development in camera-type eye and biological process this GO :0002651 and positive regulation of tolerance induction to self antigen and biological process this GO :0002663 and positive regulation of B cell tolerance induction and biological process this GO :0002666 and positive regulation of T cell tolerance induction and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005026 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004872 : receptor activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005026 : transforming growth factor beta receptor activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004872 : receptor activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005026 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005539 : glycosaminoglycan binding, this GO :0016772 : transferase activity, this GO :0031435 : mitogen-activated protein kinase kinase kinase binding, this GO :0034713 : type I transforming growth factor beta receptor binding, this GO :0034714 : type III transforming growth factor beta receptor binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0031435 : mitogen-activated protein kinase kinase kinase binding and also this GO :0034713 : type I transforming growth factor beta receptor binding and also this GO :0034714 : type III transforming growth factor beta receptor binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030324 and lung development and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0031100 and organ regeneration and biological process this GO :0031435 and mitogen-activated protein kinase kinase kinase binding and molecular function this GO :0032147 and activation of protein kinase activity and biological process this GO :0034713 and type I transforming growth factor beta receptor binding and molecular function this GO :0034714 and type III transforming growth factor beta receptor binding and molecular function this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042060 and wound healing and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043235 and receptor complex and cellular component this GO :0043415 and positive regulation of skeletal muscle tissue regeneration and biological process this GO :0043627 and response to estrogen and biological process this GO :0045121 and membrane raft and cellular component this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048545 and response to steroid hormone and biological process this GO :0048565 and digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048701 and embryonic cranial skeleton morphogenesis and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051138 and positive regulation of NK T cell differentiation and biological process this GO :0051216 and cartilage development and biological process this GO :0060021 and palate development and biological process this GO :0060044 and negative regulation of cardiac muscle cell proliferation and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060433 and bronchus development and biological process this GO :0060434 and bronchus morphogenesis and biological process this GO :0060439 and trachea morphogenesis and biological process this GO :0060440 and trachea formation and biological process this GO :0060443 and mammary gland morphogenesis and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0070022 and transforming growth factor beta receptor homodimeric complex and cellular component this GO :0070723 and response to cholesterol and biological process this GO :1990086 and lens fiber cell apoptotic process and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, transforming growth factor beta receptor activity, type II, type II and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005539 : glycosaminoglycan binding and also this GO :0016772 : transferase activity, type II and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005539 and glycosaminoglycan binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007369 and gastrulation and biological process this GO :0007420 and brain development and biological process this GO :0007507 and heart development and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007584 and response to nutrient and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009749 and response to glucose and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010033 and response to organic substance and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016772 and transferase activity, 66001 and IDBG-644071 and ENSBTAG00000019832 and 535376, transforming growth factor
Identity: 11773
Gene: TGFBR2 | More about : TGFBR2
Long gene name: transforming growth factor beta receptor 2
Synonyms gene: MFS2
Synonyms gene name: beta receptor II (70/80kDa) transforming growth factor beta receptor II , transforming growth factor
Locus: 3p24, 1
Discovery year: 1993-09-30
Entrez gene record: 7048
Pubmed identfication: 1319842 15235604
Classification: Type 2 receptor serine/threonine kinases
Havana BLAST/BLAT: OTTHUMG00000130569
Locus Specific Databases: Belgium The TGFBR2 mutations database LRG_779 , Ghent, LOVD - Center for Medical Genetics

Related Products :

MBS618947 Transforming Growth Factor beta2 Receptor (16CT) (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) 200ug 658 € MBS Polyclonals_1 human
MBS612691 Transforming Growth Factor beta2 Receptor (28NT) (TGFb2R, TGFBR2, Transforming Growth Factor beta Receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) Antibody 200ug 608 € MBS Polyclonals_1 human
MBS623133 bTransforming Growth Factor beta2 Receptor (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
CC10 Recombinant Human Transforming Growth Factor Receptor Type II, TGFBR2 (C-Fc) 1 mg 2283 € novo human
CM05 Recombinant Mouse Transforming Growth Factor-β Receptor Type II, TGFBR2 (C-6His) 50 µg 232 € novo human
CM04 Recombinant Mouse Transforming Growth Factor-β Receptor Type II, TGFBR2 (C-Fc) 500 µg 1328 € novo human
DL-TGFbR2-Hu Human Transforming Growth Factor Beta Receptor II TGFbR2 ELISA Kit 96T 846 € DL elisas human
DL-TGFbR2-Mu Mouse Transforming Growth Factor Beta Receptor II TGFbR2 ELISA Kit 96T 846 € DL elisas mouse
EKU07823 Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU07824 Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS621744 Transforming Growth Factor beta3 (Transforming Growth Factor beta 3, TGF beta 3, TGF beta3, TGFb3, ARVD, FLJ16571) Antibody 500ul 713 € MBS Polyclonals_1 human
MBS621901 SHC-Transforming Protein 2 (Src Homology 2 Domain-Containing-Transforming Protein C2, SH2 Domain Protein C2, SHC-Transforming Protein B, Protein Sck, SHC2, SCK, SHCB) 100ug 752 € MBS Polyclonals_1 human
MBS621077 TrkA (Tyrosine Kinase Receptor A) (High affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, TRK1 transforming tyrosine kinase protein, p140-TrkA, Trk-A, GENE NAME: NTRK1, TRK) 100ul 652 € MBS Polyclonals_1 human
MBS612244 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Antibody 100ug 591 € MBS Polyclonals_1 human
MBS622371 TGF beta-induced Factor 2 (Transforming Growth Factor beta-induced Factor 2, TGF (beta)-induced Transcription Factor 2, TGFB-induced Factor 2, TGIF2, 5'-TG-3' Interacting Factor 2, 5'-TG-3'-interacting Factor 2, Homeobox Protein TGIF2) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
GWB-FE5DB3 Recombinant Human Transforming Growth Factor Beta Receptor II bulk Ask price € genways bulk human
GWB-5E847D Transforming Growth Factor B Receptor Type 1 (TGFBR1) Rabbit antibody to or anti-Human Polyclonal (aa158-179) antibody 1 tube 648 € genways human
MEDCLA746-01 Transforming Growth Factor beta Receptor (TGF-ßR) (type 1), external domain, Clone: 8A11, Mouse Monoclonal antibody-Human; paraffin, IH/No WB 0.1000ul 428 € accurate-monoclonals human
MEDCLA746-1 Transforming Growth Factor beta Receptor (TGF-ßR) (type 1), external domain, Clone: 8A11, Mouse Monoclonal antibody-Human; paraffin, IH/No WB 1000ul 1243 € accurate-monoclonals human
abx168273 Anti-Transforming Growth Factor beta Receptor I Protein (Recombinant) 10 μg 412 € abbex human
abx167442 Anti-Transforming Growth Factor beta Receptor II Protein (Recombinant) 100 μg 891 € abbex human
abx167259 Anti-Transforming Growth Factor beta Receptor III Protein (Recombinant) 10 μg 398 € abbex human
MBS616823 Axl, phosphorylated (Tyr779) (AXL Oncogene, AXL Receptor Tyrosine Kinase, AXL Transforming Gene, AXL Transforming Sequence/gene, Adhesion-related Kinase, Ark, Oncogene AXL, Tyrosine Protein Kinase Receptor, UFO, TYR07) Antibody 100ug 680 € MBS Polyclonals_1 human
MBS613887 Transforming Growth Factor beta Receptor III (TGF beta Receptor III, TGF beta RIII, TGFR-3, Betaglycan) Antibody 0.25 miligrams 774 € MBS Polyclonals_1 human
MBS615346 Transforming Growth Factor beta Receptor III (TGF beta Receptor III, TGF beta RIII, TGFR-3, Betaglycan) (Carboxyfluorescein) Antibody 100 Tests 768 € MBS Polyclonals_1 human
MBS618581 Transforming Growth Factor beta Receptor III (TGF beta Receptor III, TGF beta RIII, TGFR-3, Betaglycan) (PE) Antibody 100 Tests 768 € MBS Polyclonals_1 human
MBS624351 CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human