| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Thr23-Asp159 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
42, 6 kD |
| UniProt number: |
P37173 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TGFBR2 (C-Fc), Transforming Growth Factor Receptor II |
| Short name: |
TGFBR2 (C-Fc), Recombinant Transforming Growth Factor Receptor II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
b receptor II (70/80kDa) (C-fragment c), sapiens Transforming Growth Factor Receptor classification II, transforming growth factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AAT3 and FAA3 and LDS1B and LDS2 and LDS2B and MFS2 and RIIC and TAAD2 and TGFbeta-RII and TGFR-2, BT, Cell surfaces, TGFBR2 and IDBG-23359 and ENSG00000163513 and 7048, Tgfbr2 and IDBG-203902 and ENSMUSG00000032440 and 21813, beta receptor II (70/80kDa), this GO :0001568 and blood vessel development and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002053 and positive regulation of mesenchymal cell proliferation and biological process this GO :0002088 and lens development in camera-type eye and biological process this GO :0002651 and positive regulation of tolerance induction to self antigen and biological process this GO :0002663 and positive regulation of B cell tolerance induction and biological process this GO :0002666 and positive regulation of T cell tolerance induction and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005026 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004872 : receptor activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005026 : transforming growth factor beta receptor activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004872 : receptor activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005026 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005539 : glycosaminoglycan binding, this GO :0016772 : transferase activity, this GO :0031435 : mitogen-activated protein kinase kinase kinase binding, this GO :0034713 : type I transforming growth factor beta receptor binding, this GO :0034714 : type III transforming growth factor beta receptor binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0031435 : mitogen-activated protein kinase kinase kinase binding and also this GO :0034713 : type I transforming growth factor beta receptor binding and also this GO :0034714 : type III transforming growth factor beta receptor binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030324 and lung development and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0031100 and organ regeneration and biological process this GO :0031435 and mitogen-activated protein kinase kinase kinase binding and molecular function this GO :0032147 and activation of protein kinase activity and biological process this GO :0034713 and type I transforming growth factor beta receptor binding and molecular function this GO :0034714 and type III transforming growth factor beta receptor binding and molecular function this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042060 and wound healing and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043235 and receptor complex and cellular component this GO :0043415 and positive regulation of skeletal muscle tissue regeneration and biological process this GO :0043627 and response to estrogen and biological process this GO :0045121 and membrane raft and cellular component this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048545 and response to steroid hormone and biological process this GO :0048565 and digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048701 and embryonic cranial skeleton morphogenesis and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051138 and positive regulation of NK T cell differentiation and biological process this GO :0051216 and cartilage development and biological process this GO :0060021 and palate development and biological process this GO :0060044 and negative regulation of cardiac muscle cell proliferation and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060433 and bronchus development and biological process this GO :0060434 and bronchus morphogenesis and biological process this GO :0060439 and trachea morphogenesis and biological process this GO :0060440 and trachea formation and biological process this GO :0060443 and mammary gland morphogenesis and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0070022 and transforming growth factor beta receptor homodimeric complex and cellular component this GO :0070723 and response to cholesterol and biological process this GO :1990086 and lens fiber cell apoptotic process and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, transforming growth factor beta receptor activity, type II, type II and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005539 : glycosaminoglycan binding and also this GO :0016772 : transferase activity, type II and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005539 and glycosaminoglycan binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007369 and gastrulation and biological process this GO :0007420 and brain development and biological process this GO :0007507 and heart development and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007584 and response to nutrient and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009749 and response to glucose and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010033 and response to organic substance and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016772 and transferase activity, 66001 and IDBG-644071 and ENSBTAG00000019832 and 535376, transforming growth factor |
| Identity: |
11773 |
| Gene: |
TGFBR2 |
More about : TGFBR2 |
| Long gene name: |
transforming growth factor beta receptor 2 |
| Synonyms gene: |
MFS2 |
| Synonyms gene name: |
beta receptor II (70/80kDa) transforming growth factor beta receptor II , transforming growth factor |
| Locus: |
3p24, 1 |
| Discovery year: |
1993-09-30 |
| Entrez gene record: |
7048 |
| Pubmed identfication: |
1319842 15235604 |
| Classification: |
Type 2 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000130569 |
| Locus Specific Databases: |
Belgium The TGFBR2 mutations database LRG_779 , Ghent, LOVD - Center for Medical Genetics |