| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human NGFRAP1 is produced by our Mammalian expression system and the target gene encoding Met1-Pro111 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
40 kD |
| UniProt number: |
Q00994 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BEX3, NGFRAP1 |
| Short name: |
BEX3, Recombinant NGFRAP1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BEX3, sapiens nerve growth factor receptor (TNFRSF16) associated protein 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
NGFRAP1 and IDBG-633850 and ENSBTAG00000006026 and 100034674, NGFRAP1 and IDBG-80577 and ENSG00000166681 and 27018, Ngfrap1 and IDBG-173089 and ENSMUSG00000046432 and 12070, metal ion binding, nuclei, this GO :0005123 and death receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008656 and cysteine-type endopeptidase activator activity involved in apoptotic process and molecular function this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0005123 : death receptor binding, this GO :0005123 : death receptor binding and also this GO :0005515 : protein binding and also this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process and also this GO :0046872 : metal ion binding, this GO :0005515 : protein binding, this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process, this GO :0046872 : metal ion binding, nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Identity: |
13388 |
| Gene: |
BEX3 |
More about : BEX3 |
| Long gene name: |
brain expressed X-linked 3 |
| Synonyms gene: |
NGFRAP1 |
| Synonyms gene name: |
nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Synonyms: |
HGR74 Bex NADE DXS6984E |
| Locus: |
Xq22, 2 |
| Discovery year: |
2001-09-19 |
| GenBank acession: |
AF187064 |
| Entrez gene record: |
27018 |
| Pubmed identfication: |
10764727 16221301 2171551 |
| RefSeq identity: |
NM_014380 |
| Classification: |
Brain expressed X-linked family |
| Havana BLAST/BLAT: |
OTTHUMG00000022099 |