| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Receptor Expressed in Lymphoid Tissues is produced by our Mammalian expression system and the target gene encoding Ser26-Ala160 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
4 kD, 41 |
| UniProt number: |
Q969Z4 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
RELT, TNFRSF19L (C-Fc), Receptor Expressed in Lymphoid Tissues |
| Short name: |
RELT, TNFRSF19L (C-Fc), Recombinant Receptor Expressed in Lymphoid Tissues |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
RELT tumor necrosis factor receptor, TNFRSF19L (C-fragment c), sapiens Receptor Expressed in Lymphoid Tissues, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, RELT and IDBG-635302 and ENSBTAG00000016494 and 505716, RELT and IDBG-63781 and ENSG00000054967 and 84957, Relt and IDBG-201680 and ENSMUSG00000008318 and 320100, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, RELT tumor necrosis factor receptor |
| Identity: |
13764 |
| Gene: |
RELT |
More about : RELT |
| Long gene name: |
RELT tumor necrosis factor receptor |
| Synonyms gene: |
TNFRSF19L |
| Synonyms gene name: |
member 19-like , tumor necrosis factor receptor superfamily |
| Synonyms: |
FLJ14993 |
| Locus: |
11q13, 2 |
| Discovery year: |
2002-02-08 |
| GenBank acession: |
AF319553 |
| Entrez gene record: |
84957 |
| Pubmed identfication: |
11313261 16547002 16950202 16389068 |
| RefSeq identity: |
NM_032871 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000167973 |