Recombinant Human Fas, TNFRSF6, CD95 (C-6His)

Contact us
Catalog number: CB72
Price: 674 €
Supplier: accurate-monoclonals
Product name: Recombinant Human Fas, TNFRSF6, CD95 (C-6His)
Quantity: 1000ul
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Fas is produced by our Mammalian expression system and the target gene encoding Gln26-Asn173 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 6 kD
UniProt number: P25445
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD95 (C-6His), TNFRSF6, Fas
Short name: CD95 (C-6His), TNFRSF6, Recombinant Fas
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD95 (C-6His), TNFRSF6, member 6), sapiens Fas (TNF receptor superfamily, recombinant H
Alternative technique: rec
Identity: 11920
Gene: FAS | More about : FAS
Long gene name: Fas cell surface death receptor
Synonyms gene: FAS1 APT1 TNFRSF6
Synonyms gene name: member 6 Fas (TNF receptor superfamily, member 6) , tumor necrosis factor receptor superfamily
Synonyms: CD95 APO-1
Synonyms name: TNF receptor superfamily member 6
Locus: 10q23, 31
Discovery year: 1992-06-25
GenBank acession: M67454
Entrez gene record: 355
Pubmed identfication: 1385299 1385309
Classification: CD molecules Tumor necrosis factor receptor superfamily Death inducing signaling complex
Havana BLAST/BLAT: OTTHUMG00000018701
Locus Specific Databases: Autoimmune Lymphoproliferative Syndrome Database (ALPSbase): Database of mutations causing human ALPS LOVD at NCBI LRG_134

Related Products :

CB72 Recombinant Human Fas, TNFRSF6, CD95 (C-6His) 10 µg 146 € novo human
CP49 Recombinant Mouse Fas, TNFRSF6, CD95 (C-6His) 500 µg 1613 € novo mouse
RP-0674H Recombinant Human FAS / CD95 / APO-1 / TNFRSF6 Protein (Fc Tag) 50μg 624 € adv human
RP-0673H Recombinant Human FAS / CD95 / APO-1 / TNFRSF6 Protein (His Tag) 50μg 624 € adv human
CD46 Recombinant Human Fas, TNFRSF6, CD95 (C-Fc) 500 µg 1613 € novo human
RP-1090RC Recombinant Cynomolgus FAS / CD95 / APO-1 / TNFRSF6 Protein (Fc Tag) 50μg 659 € adv human
RP-1280M Recombinant Mouse FAS / CD95 / APO-1 / TNFRSF6 Protein (His Tag) 50μg 624 € adv mouse
CP50 Recombinant Mouse Fas, TNFRSF6, CD95 (C-Fc) 10 µg 146 € novo mouse
RP-2131R Recombinant Rat FAS / CD95 / APO-1 / TNFRSF6 Protein (Fc Tag) 50μg 624 € adv rat
RP-2132R Recombinant Rat FAS / CD95 / APO-1 / TNFRSF6 Protein (His Tag) 50μg 624 € adv rat
MBS623986 FAS, ID (Tumor Necrosis Factor Receptor Superfamily Member 6, FASLG Receptor, Apoptosis-mediating Surface Antigen FAS, Apo-1 Antigen, CD95, FAS, APT1, FAS1, TNFRSF6) Antibody 200ul 603 € MBS Polyclonals_1 human
GWB-5B3CFF Tumor Necrosis Factor Receptor Superfamily Member 6 (TNFRSF6) (FAS) Mouse antibody to or anti-Human Monoclonal (LT95) antibody 1 x 1 vial 602 € genways human
MBS300439 Anti-Human CD95/FAS PAb 7 ml (RTU) 437 € MBS Polyclonals_1 human
MBS300440 Anti-Human CD95/FAS PAb 1 mililiter 542 € MBS Polyclonals_1 human
MBS301119 Anti-Human CD95/FAS PAb 100ul 232 € MBS Polyclonals_1 human
MBS302385 Anti-Human CD95/FAS PAb 500ul 387 € MBS Polyclonals_1 human
AXL7276F CD95, Apolipoprotein 1, FAS, Clone: DX2, Mouse Monoclonal antibody-Human, FITC 1000ul 1942 € accurate-monoclonals human
AXL7277RPE CD95, Apolipoprotein 1, FAS, Clone: DX2, Mouse Monoclonal antibody-Human, RPE 1000ul 2173 € accurate-monoclonals human
AXL3678M CD95, Apolipoprotein 1, FAS, Clone: DX3, Mouse Monoclonal antibody-Human 1000ul Ask price € accurate-monoclonals human
SBA973514 CD95, Apolipoprotein 1, FAS, Clone: DX3, Mouse Monoclonal antibody-Human 1000ul 1440 € accurate-monoclonals human
AXL3677M CD95, Apolipoprotein 1, FAS/RPE, Clone: DX2, Mouse Monoclonal antibody-Human; paraffin (pretreat) 1000ul 2398 € accurate-monoclonals human
MEDCLA310 CD95, Fas, 48kD, Clone: 11G10, Mouse Monoclonal antibody-Human; frozen 1000ul Ask price € accurate-monoclonals human
MEDCLA551-01 CD95, Fas, 48kD, Clone: GM30, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/No WB 0.1000ul 428 € accurate-monoclonals human
MEDCLA551-1 CD95, Fas, 48kD, Clone: GM30, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/No WB 1000ul 1293 € accurate-monoclonals human
MEDCLA912 CD95, Fas, 48kD, Clone: LOB3-17, Mouse Monoclonal antibody-Human, FITC; flow 100 tests Ask price € accurate-monoclonals human
MEDCLA839 CD95, Fas, 48kD, Clone: LOB3-17, Mouse Monoclonal antibody-Human; frozen/NO paraffin, IH/flow/No WB 1000ul 1017 € accurate-monoclonals human
BMDV7110 CD95, FAS Antigen, 40-45kD, Clone: G-30, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/flow 500ul 489 € accurate-monoclonals human
CLBM1714 CD95, Fas, APO-1, Clone: FAS18, Mouse Monoclonal antibody-Human, Induces Apoptosis 1000ul 674 € accurate-monoclonals human
CLBM1735 CD95, Fas, APO-1, Clone: FAS19, Mouse Monoclonal antibody-Human, FITC, Inhibits Induction of Apoptosis by FAS18 1000ul 674 € accurate-monoclonals human
CLBM1715 CD95, Fas, APO-1, Clone: FAS19, Mouse Monoclonal antibody-Human, Inhibits Induction of Apoptosis by FAS18 1000ul 674 € accurate-monoclonals human