| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Apolipoprotein C-II is produced by our E, coli expression system and the target gene encoding Met1-Glu82 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
10 kD |
| UniProt number: |
P02655 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2, 2 um filtered solution of 20 mMPB, 30%glycerol, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
APOC2 (C-6His), Apolipoprotein C-II |
| Short name: |
APOC2 (C-6His), Recombinant Apolipoprotein C-II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
apolipoprotein C-II (C-6His), sapiens Apolipoprotein C-II, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
APO-CII and APOC-II, APOC2 and IDBG-306903 and ENSG00000234906 and 344, APOC2 and IDBG-639315 and ENSBTAG00000020558 and 618039, Apoc2 and IDBG-151996 and ENSMUSG00000002992 and 11813, Extracellular, lipoprotein lipase activator activity, this GO :0001523 and retinoid metabolic process and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005769 and early endosome and cellular component this GO :0006629 and lipid metabolic process and biological process this GO :0006869 and lipid transport and biological process this GO :0007603 and phototransduction, this GO :0008047 : enzyme activator activity, this GO :0008047 : enzyme activator activity and also this GO :0008289 : lipid binding and also this GO :0016004 : phospholipase activator activity and also this GO :0042803 : protein homodimerization activity and also this GO :0043274 : phospholipase binding and also this GO :0055102 : lipase inhibitor activity and also this GO :0060230 : lipoprotein lipase activator activity, this GO :0008289 : lipid binding, this GO :0016004 : phospholipase activator activity, this GO :0042803 : protein homodimerization activity, this GO :0043274 : phospholipase binding, this GO :0055102 : lipase inhibitor activity, this GO :0060230 : lipoprotein lipase activator activity, visible light and biological process this GO :0008047 and enzyme activator activity and molecular function this GO :0008289 and lipid binding and molecular function this GO :0010518 and positive regulation of phospholipase activity and biological process this GO :0010898 and positive regulation of triglyceride catabolic process and biological process this GO :0010902 and positive regulation of very-low-density lipoprotein particle remodeling and biological process this GO :0010916 and negative regulation of very-low-density lipoprotein particle clearance and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0016042 and lipid catabolic process and biological process this GO :0032375 and negative regulation of cholesterol transport and biological process this GO :0033344 and cholesterol efflux and biological process this GO :0033700 and phospholipid efflux and biological process this GO :0034361 and very-low-density lipoprotein particle and cellular component this GO :0034362 and low-density lipoprotein particle and cellular component this GO :0034363 and intermediate-density lipoprotein particle and cellular component this GO :0034366 and spherical high-density lipoprotein particle and cellular component this GO :0034370 and triglyceride-rich lipoprotein particle remodeling and biological process this GO :0034371 and chylomicron remodeling and biological process this GO :0034372 and very-low-density lipoprotein particle remodeling and biological process this GO :0034382 and chylomicron remnant clearance and biological process this GO :0034384 and high-density lipoprotein particle clearance and biological process this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042627 and chylomicron and cellular component this GO :0042632 and cholesterol homeostasis and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043086 and negative regulation of catalytic activity and biological process this GO :0043274 and phospholipase binding and molecular function this GO :0043691 and reverse cholesterol transport and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045723 and positive regulation of fatty acid biosynthetic process and biological process this GO :0045833 and negative regulation of lipid metabolic process and biological process this GO :0048261 and negative regulation of receptor-mediated endocytosis and biological process this GO :0051006 and positive regulation of lipoprotein lipase activity and biological process this GO :0055102 and lipase inhibitor activity and molecular function this GO :0060230 and lipoprotein lipase activator activity and molecular function this GO :0060697 and positive regulation of phospholipid catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070328 and triglyceride homeostasis and biological process, apolipoprotein C-II |
| Identity: |
609 |
| Gene: |
APOC2 |
More about : APOC2 |
| Long gene name: |
apolipoprotein C2 |
| Synonyms gene name: |
apolipoprotein C-II |
| Locus: |
19q13, 32 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X00568 |
| Entrez gene record: |
344 |
| RefSeq identity: |
NM_000483 |
| Classification: |
Apolipoproteins |
| Havana BLAST/BLAT: |
OTTHUMG00000180847 |