Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-Fc)

Contact us
Catalog number: CB41
Price: 564 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-Fc)
Quantity: 100ul
Other quantities: 1 mg 2283€ 10 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human V-Set and Ig Domain-Containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly263 is expressed with a Fc tag at the C-terminus
Molecular Weight: 2 kD, 54
UniProt number: Q5VU13
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VSIG8 (C-Fc), V-Set Ig Domain Protein 8
Short name: VSIG8 (C-Fc), Recombinant V-Set Ig Domain- Protein 8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: V-set and immunoglobulin domain containing 8 (C-fragment c), sapiens V-Set and Ig Domain-Containing Protein 8, recombinant H
Alternative technique: rec
Alternative to gene target: Plasma membranes, VSIG8 and IDBG-409230 and ENSG00000243284 and 391123, VSIG8 and IDBG-630698 and ENSBTAG00000010670 and 520493, Vsig8 and IDBG-205594 and ENSMUSG00000049598 and 240916, poly(A) RNA binding, this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0044822 and poly(A) RNA binding and molecular function, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0044822 : poly(A) RNA binding, this GO :0044822 : poly(A) RNA binding, V-set and immunoglobulin domain containing 8
Identity: 32063
Gene: VSIG8 | More about : VSIG8
Long gene name: V-set and immunoglobulin domain containing 8
Locus: 1q23, 2
Discovery year: 2005-12-01
Entrez gene record: 391123
RefSeq identity: NM_001013661
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000168834

Related Products :

MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
CP78 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 1 mg 2283 € novo human
CB41 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-Fc) 10 µg 156 € novo human
CP79 Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 500 µg 1613 € novo mouse
MBS620170 SET7 (SET Domain Containing Protein 7, SET Domain-containing Protein 7, SET7/9, SET9, SETD7, FLJ21193, H3-K4-HMTase, H3 Lysine-4 Specific, Histone H3 K4 Methyltransferase, Histone H3-K4 Methyltransferase, Histone H3 Lysine 4 Specific Methyltransferase, Hi 100ul 785 € MBS Polyclonals_1 human
MBS619444 FBXW7 (F-box and WD 40 Domain Protein 7, F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, F-box/WD-repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, Antibody 100ul 785 € MBS Polyclonals_1 drosophila
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
MBS614185 CLAN (CARD 12, CARD LRR and NACHT containing protein 1, CARD LRR and NACHT containing protein, Caspase recruitment domain containing protein 12, CLAN 1, CLAN A, CLAN, CLAN B, CLAN C, CLAN D, Clan protein, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR 2.1, CLR2.1 Antibody 100ug 575 € MBS Polyclonals_1 human
MBS615326 ARFBP1 (HUWE1. HECT, UBA and WWE domain containing 1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1, HECT, UBA and WWE domain-containing protein 1, HectH9, HECTH9, Homologous to E6AP carboxyl terminus homologous protein 9, HSPC272, Ib7 Antibody 100ug 569 € MBS Polyclonals_1 human
MBS623954 SETDB1, CT (Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, SET Domain Bifurcated 1, ERG-associated Protein with SET Domain, Histone-lysine N-methyltransferase SETDB1, Lysine N-methyltransferase 1E, ESET, KIAA0067, KMT1E) 200ul 603 € MBS Polyclonals_1 human
C548 Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His) 10 µg 131 € novo human
C549 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-6His) 10 µg 121 € novo human
CD69 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-Fc) 50 µg 263 € novo human
CJ71 Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His) 10 µg 156 € novo human
CI23 Recombinant Human V-Set and Transmembrane Domain-Containing 2A, VSTM2A (C-6His) 500 µg 1613 € novo human
abx263202 Anti-V-Set and Transmembrane Domain Containing 2 Like Protein (Recombinant) 100 µg 1543 € abbex human
LV356321 VSIG8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
MBS622587 SH2 domain protein 2A (SH2D2A, F2771, SCAP, SH2 domain-containing adapter protein, SH2 domain-containing protein 2A, T cell-specific adapter protein, TSAd, TSAD, VEGF receptor-associated protein, VRAP) 100ug 774 € MBS Polyclonals_1 human
AP54521PU-N anti-VSIG8 (C-term) Antibody 0,4 ml 587 € acr human
abx939569 Anti-VSIG8 siRNA inquire 50 € abbex human
abx939570 Anti-VSIG8 siRNA 30 nmol 717 € abbex human
GWB-MP910A VSIG8 antibody 1 vial 521 € genways human
GWB-315BC6 VSIG8 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS619233 SH2D3A (SH2 Domain Containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) 100ug 591 € MBS Polyclonals_1 human
MBS620754 PLEKHB1 (Pleckstrin homology domain containing, family B (evectins) member 1, KPL1, PHR1, PHRET1, PH domain containing protein in retina 1, PH domain containing, retinal 1) 100ug 591 € MBS Polyclonals_1 human
MBS610920 NONO (Non Pou Domain Containing Octamer (ATGCAAAT) Binding Protein, Non-POU Domain-containing, Octamer-binding Protein, NonO Protein, 54kD Nuclear RNA and DNA Binding Protein, 55kD Nuclear Protein, DNA Binding p52/p100 Complex 52kD Subunit, HGNC:7871, NMT Antibody 100ul 785 € MBS Polyclonals_1 human
MBS613081 PHLPP (PH Domain and Leucine-rich Repeat Protein Phosphatase, PH Domain Leucine-rich Repeat Protein Phosphatase, PH Domain Leucine-rich Repeat-containing Protein Phosphatase, PHLPP1, KIAA0606 Protein, Pleckstrin Homology Domain-containing Family E Protein Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619787 Nucleus accumbens-associated protein 1 (NACC1, Nucleus accumbens associated 1, BEN and BTB (POZ) domain containing, BEND8, BTB/POZ domain-containing protein 14B, BTBD14B, FLJ37383, NAC1, NAC-1) Antibody 100ul 564 € MBS Polyclonals_1 human