Recombinant Human Neurotrimin, NTRI (C-6His)

Contact us
Catalog number: CB27
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Neurotrimin, NTRI (C-6His)
Quantity: 0.1ml
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Neurotrimin is produced by our Mammalian expression system and the target gene encoding Gly34-Leu316 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 32
UniProt number: Q9P121-3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NTRI (C-6His), Neurotrimin
Short name: NTRI (C-6His), Recombinant Neurotrimin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NTRI (C-6His), sapiens Neurotrimin, recombinant H
Alternative technique: rec
Identity: 17941
Gene: NTM | More about : NTM
Long gene name: neurotrimin
Synonyms: HNT NTRI IGLON2
Synonyms name: neurotrimin IgLON family member 2
Locus: 11q25
Discovery year: 2009-01-12
GenBank acession: AF126426
Entrez gene record: 50863
Pubmed identfication: 7891157
RefSeq identity: NM_016522
Classification: I-set domain containing IgLON cell adhesion molecules
Havana BLAST/BLAT: OTTHUMG00000066364

Related Products :

CB27 Recombinant Human Neurotrimin, NTRI (C-6His) 10 µg 202 € novo human
101-M580 Anti-Human Neurotrimin 100ug 336 € Reliatech antibodies human
GENTAUR-58bd8eaa11f28 Human Neurotrimin (NTM) 100ug 1840 € MBS Recombinant Proteins human
GENTAUR-58bd8eaa7456e Human Neurotrimin (NTM) 1000ug 1840 € MBS Recombinant Proteins human
GENTAUR-58bd8eab2806c Human Neurotrimin (NTM) 100ug 2354 € MBS Recombinant Proteins human
GENTAUR-58bd8eab8087b Human Neurotrimin (NTM) 1000ug 2354 € MBS Recombinant Proteins human
MBS242778 PAb (IgG) to Human NTM / Neurotrimin 50ug 597 € MBS Polyclonals_1 human
C17036-1 anti-Neurotrimin Antibody 50 Вµg 347 € acr human
C17036-2 anti-Neurotrimin Antibody 0,1 mg 500 € acr human
CPA2656-100ul anti-Neurotrimin Antibody 0,1 ml 442 € acr human
CPA2656-200ul anti-Neurotrimin Antibody 0,2 ml 688 € acr human
CPA2656-30ul anti-Neurotrimin Antibody 30 Вµl 326 € acr human
AP31263PU-N anti-Neurotrimin (C-term) Antibody 50 Вµg 732 € acr human
GENTAUR-58be5abb2e3c7 Anti-Neurotrimin/HNT (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
AE30232BO Bovine Neurotrimin (NTM) ELISA Kit 96 wells plate 810 € ab-elisa elisas bovine
AE30232BO-96 Bovine Neurotrimin (NTM) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE30232BO-48 ELISA test for Bovine Neurotrimin (NTM) 1x plate of 48 wells 402 € abebio bovine
bs-11082R-A350 Neurotrimin/HNT Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11082R-A488 Neurotrimin/HNT Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11082R-A555 Neurotrimin/HNT Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11082R-A594 Neurotrimin/HNT Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11082R-A647 Neurotrimin/HNT Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11082R-Biotin Neurotrimin/HNT Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11082R Neurotrimin/HNT Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11082R-Cy3 Neurotrimin/HNT Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11082R-Cy5 Neurotrimin/HNT Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11082R-Cy5.5 Neurotrimin/HNT Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11082R-Cy7 Neurotrimin/HNT Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11082R-FITC Neurotrimin/HNT Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11082R-HRP Neurotrimin/HNT Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human