Recombinant Human Neurotrimin, NTRI (C-6His)

Catalog number:	CB27 Buy Now
Price:	350 €
Supplier:	Bioss Primary Conjugated Antibodies
Product name:	Recombinant Human Neurotrimin, NTRI (C-6His)
Quantity:	0.1ml
Other quantities:	1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:	human neurotrimin gene ntri iglon alternative

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Neurotrimin is produced by our Mammalian expression system and the target gene encoding Gly34-Leu316 is expressed with a 6His tag at the C-terminus
Molecular Weight:	3 kD, 32
UniProt number:	Q9P121-3
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVLVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	NTRI (C-6His), Neurotrimin
Short name:	NTRI (C-6His), Recombinant Neurotrimin
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	NTRI (C-6His), sapiens Neurotrimin, recombinant H
Alternative technique:	rec
Identity:	17941
Gene:	NTM | More about : NTM
Long gene name:	neurotrimin
Synonyms:	HNT NTRI IGLON2
Synonyms name:	neurotrimin IgLON family member 2
Locus:	11q25
Discovery year:	2009-01-12
GenBank acession:	AF126426
Entrez gene record:	50863
Pubmed identfication:	7891157
RefSeq identity:	NM_016522
Classification:	I-set domain containing IgLON cell adhesion molecules
Havana BLAST/BLAT:	OTTHUMG00000066364

• #human
• #neurotrimin
• #gene
• #ntri
• #iglon
• #alternative