Recombinant Human Pancreatic Lipase-Related Protein 2, PLRP2 (C-6His)

Contact us
Catalog number: CA52
Price: 370 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Pancreatic Lipase-Related Protein 2, PLRP2 (C-6His)
Quantity: 50ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Pancreatic Lipase-Related Protein 2 is produced by our Mammalian expression system and the target gene encoding Lys18-Cys469 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16 kD, 51
UniProt number: P54317
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM GaCl2, 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPCLDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PLRP2 (C-6His), Pancreatic Lipase-Related Protein 2
Short name: PLRP2 (C-6His), Recombinant Pancreatic Lipase- Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PLRP2 (C-6His), sapiens Pancreatic Lipase-Related Protein 2, recombinant H
Alternative technique: rec
Identity: 9157
Gene: PNLIPRP2 | More about : PNLIPRP2
Long gene name: pancreatic lipase related protein 2 (gene/pseudogene)
Synonyms gene name: pancreatic lipase related protein 2
Synonyms: PLRP2
Locus: 10q25, 3
Discovery year: 1994-04-28
GenBank acession: M93284
Entrez gene record: 5408
Pubmed identfication: 1379598
RefSeq identity: NM_005396
Classification: Lipases
Havana BLAST/BLAT: OTTHUMG00000181599

Related Products :

CA52 Recombinant Human Pancreatic Lipase-Related Protein 2, PLRP2 (C-6His) 10 µg 156 € novo human
C681 Recombinant Human Pancreatic Lipase-Related Protein 1, PLRP1 (C-6His) 500 µg 1613 € novo human
GENTAUR-58b9ddab99dfa Bovine Pancreatic lipase-related protein 2 (PNLIPRP2) 100ug 2260 € MBS Recombinant Proteins bovine
GENTAUR-58b9ddac79e2c Bovine Pancreatic lipase-related protein 2 (PNLIPRP2) 1000ug 2260 € MBS Recombinant Proteins bovine
GENTAUR-58b9ddacd3a2f Bovine Pancreatic lipase-related protein 2 (PNLIPRP2) 100ug 2774 € MBS Recombinant Proteins bovine
GENTAUR-58b9ddad24f85 Bovine Pancreatic lipase-related protein 2 (PNLIPRP2) 1000ug 2774 € MBS Recombinant Proteins bovine
GENTAUR-58bda86804966 Mouse Pancreatic lipase-related protein 1 (Pnliprp1) 100ug 2271 € MBS Recombinant Proteins mouse
GENTAUR-58bda8686afd6 Mouse Pancreatic lipase-related protein 1 (Pnliprp1) 1000ug 2271 € MBS Recombinant Proteins mouse
GENTAUR-58bda868bca41 Mouse Pancreatic lipase-related protein 1 (Pnliprp1) 100ug 2785 € MBS Recombinant Proteins mouse
GENTAUR-58bda8693e0ff Mouse Pancreatic lipase-related protein 1 (Pnliprp1) 1000ug 2785 € MBS Recombinant Proteins mouse
GENTAUR-58bda24110c1a Myocastor coypus Pancreatic lipase-related protein 2 (PNLIPRP2) 100ug 2260 € MBS Recombinant Proteins human
GENTAUR-58bda2414dffc Myocastor coypus Pancreatic lipase-related protein 2 (PNLIPRP2) 1000ug 2260 € MBS Recombinant Proteins human
GENTAUR-58bda241a3214 Myocastor coypus Pancreatic lipase-related protein 2 (PNLIPRP2) 100ug 2774 € MBS Recombinant Proteins human
GENTAUR-58bda2420b48a Myocastor coypus Pancreatic lipase-related protein 2 (PNLIPRP2) 1000ug 2774 € MBS Recombinant Proteins human
MBS611584 Pancreatic Lipase-related Protein 2 (PNLIPRP2) Antibody 50ug 625 € MBS Polyclonals_1 human
CI10 Recombinant Human Pancreatic Polypeptide, PPY (C-6His) 10 µg 202 € novo human
CA30 Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His) 10 µg 202 € novo human
AE22529HU-48 ELISA test for Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) 1x plate of 48 wells 402 € abebio human
AE22529HU Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE22529HU-96 Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 1x plate of 96 wells 671 € abebio human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
C657 Recombinant Human Gastric Triacylglycerol Lipase, LIPF (C-6His) 50 µg 496 € novo human
abx156730 Anti-Human Lipase, Pancreatic ELISA Kit 96 tests 891 € abbex human
abx250913 Anti-Human Pancreatic triacylglycerol lipase ELISA Kit 96 tests 659 € abbex human
KT-512 Human Pancreatic Lipase Assay 100 well plate 978 € Kamiya human
PLIP15-N Human Pancreatic Lipase (partially pure) biologically active 10 U 333 € adi human
PLIP11-M Mouse Monoclonal Anti-Human Pancreatic Lipase IgG # 1, aff pure 100 μg 565 € adi human
PLIP12-M Mouse Monoclonal Anti-Human Pancreatic Lipase IgG # 2, aff pure 100 μg 565 € adi human
Z7020090 Pancreas Tumor Tissue Array - 20 cases of pancreatic cancers and 4 cases of normal and non-malignant pancreatic tissues. 5 slides 972 € BioChain human
GENTAUR-58bdd44252f8d Anti- Lipase, Pancreatic (PL) Antibody 50ug 370 € MBS Polyclonals human