| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD160 is produced by our Mammalian expression system and the target gene encoding Ile27-Ser159 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 8 kD |
| UniProt number: |
O95971 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BY55 (C-6His), CD160 |
| Short name: |
BY55 (C-6His), Recombinant CD160 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BY55 (C-6His), sapiens CD160 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BY55 and NK1 and NK28, CD160 and IDBG-101772 and ENSG00000117281 and 11126, Cd160 and IDBG-176450 and ENSMUSG00000038304 and 54215, MHC class I receptor activity, Plasma membranes, this GO :0004872 and receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008283 and cell proliferation and biological process this GO :0032393 and MHC class I receptor activity and molecular function this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0050776 and regulation of immune response and biological process this GO :0050829 and defense response to Gram-negative bacterium and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005102 : receptor binding and also this GO :0032393 : MHC class I receptor activity, this GO :0005102 : receptor binding, this GO :0032393 : MHC class I receptor activity, CD160 molecule |
| Identity: |
17013 |
| Gene: |
CD160 |
More about : CD160 |
| Long gene name: |
CD160 molecule |
| Synonyms gene name: |
CD160 antigen |
| Synonyms: |
BY55 NK1 NK28 |
| Locus: |
1q21, 1 |
| Discovery year: |
2003-10-02 |
| GenBank acession: |
AF060981 |
| Entrez gene record: |
11126 |
| Pubmed identfication: |
9743336 9973372 |
| RefSeq identity: |
NM_007053 |
| Classification: |
Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000013749 |