| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD79B is produced by our Mammalian expression system and the target gene encoding Ala29-Asp159 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
16, 25 kD |
| UniProt number: |
P40259 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
B29 (C-6His), CD79B |
| Short name: |
B29 (C-6His), Recombinant CD79B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B29 (C-6His), immunoglobulin-associated b, sapiens CD79b molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AGM6 and B29 and IGB, CD79B and IDBG-641775 and ENSBTAG00000044204 and 509801, CD79B and IDBG-64384 and ENSG00000007312 and 974, Cd79b and IDBG-213455 and ENSMUSG00000040592 and 15985, immunoglobulin-associated beta, nuclei, protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0019815 and B cell receptor complex and cellular component this GO :0050853 and B cell receptor signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD79b molecule |
| Identity: |
1699 |
| Gene: |
CD79B |
More about : CD79B |
| Long gene name: |
CD79b molecule |
| Synonyms gene: |
IGB |
| Synonyms gene name: |
CD79B antigen (immunoglobulin-associated beta) CD79b molecule, immunoglobulin-associated beta |
| Synonyms: |
B29 |
| Locus: |
17q23, 3 |
| Discovery year: |
1992-08-04 |
| GenBank acession: |
L27587 |
| Entrez gene record: |
974 |
| Pubmed identfication: |
9545642 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000172294 |
| Locus Specific Databases: |
CD79Bbase: Mutation registry for Ig&, deficiency LRG_43 , #946 |