Recombinant Human CD79B, B29 (C-6His)

Contact us
Catalog number: CA29
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human CD79B, B29 (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD79B is produced by our Mammalian expression system and the target gene encoding Ala29-Asp159 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 25 kD
UniProt number: P40259
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: B29 (C-6His), CD79B
Short name: B29 (C-6His), Recombinant CD79B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B29 (C-6His), immunoglobulin-associated b, sapiens CD79b molecule, recombinant H
Alternative technique: rec
Alternative to gene target: AGM6 and B29 and IGB, CD79B and IDBG-641775 and ENSBTAG00000044204 and 509801, CD79B and IDBG-64384 and ENSG00000007312 and 974, Cd79b and IDBG-213455 and ENSMUSG00000040592 and 15985, immunoglobulin-associated beta, nuclei, protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0019815 and B cell receptor complex and cellular component this GO :0050853 and B cell receptor signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD79b molecule
Identity: 1699
Gene: CD79B | More about : CD79B
Long gene name: CD79b molecule
Synonyms gene: IGB
Synonyms gene name: CD79B antigen (immunoglobulin-associated beta) CD79b molecule, immunoglobulin-associated beta
Synonyms: B29
Locus: 17q23, 3
Discovery year: 1992-08-04
GenBank acession: L27587
Entrez gene record: 974
Pubmed identfication: 9545642
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000172294
Locus Specific Databases: CD79Bbase: Mutation registry for Ig&, deficiency LRG_43 , #946

Related Products :

CA29 Recombinant Human CD79B, B29 (C-6His) 500 µg 1613 € novo human
RP-1637M Recombinant Mouse CD79B / B29 Protein (His Tag) 20μg 572 € adv mouse
RP-2072R Recombinant Rat CD79B / B29 Protein (Fc Tag) 20μg 572 € adv rat
RP-2073R Recombinant Rat CD79B / B29 Protein (His Tag) 20μg 572 € adv rat
YSRTMCA1300 CD79b, B-Cell, B29, Igß, 33/40kD, Clone: ZL9-1, Mouse Monoclonal antibody-Human; frozen, IH/flow/ELISA/IP 200ug Ask price € accurate-monoclonals human
YSRTMCA1299 CD79b, B-Cell, B29, Igß, 33/40kD, Clone: ZL9-2, Mouse Monoclonal antibody-Human; frozen, IH/flow 200ug Ask price € accurate-monoclonals human
YSRTMCA2208 CD79b, B29, Clone: AT105-1, Mouse Monoclonal antibody-Human; flow/IP/WB 200ug 489 € accurate-monoclonals human
YSRTMCA2208PE CD79b, B29, Clone: AT105-1, Mouse Monoclonal antibody-Human, RPE; flow vial 432 € accurate-monoclonals human
YSRTMCA2209F CD79b, B29, Clone: AT107-2, Rat Mouse Monoclonal antibody-Human, Mouse, Rat, Dog, Swine (NO X w/Chicken), FITC; flow 0.1 mg 404 € accurate-monoclonals chicken
YSRTMCA2209 CD79b, B29, Clone: AT107-2, Rat Mouse Monoclonal antibody-Human, Mouse, Rat, Dog, Swine (NO X w/Chicken); flow/IP/ELISA/WB 200ug 489 € accurate-monoclonals chicken
GWB-A40D3B CD79b/B29 Human, antibody 1 vial 671 € genways human
GWB-25E920 Hamster antibody to or anti-Mouse CD79b (B29 Ig), antibody 1 x 1 vial 493 € genways mouse
GWB-476F71 Hamster antibody to or anti-Mouse CD79b (B29 Ig), antibody 1 x 1 vial 747 € genways mouse
GWB-5EA07A Hamster antibody to or anti-Mouse CD79b (B29 Ig), antibody 1 tube 625 € genways mouse
GWB-9D4800 Hamster antibody to or anti-Mouse CD79b (B29 Ig), antibody 1 vial 735 € genways mouse
GWB-107EA2 Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 x 1 vial 470 € genways human
GWB-25F069 Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 x 1 vial 331 € genways human
GWB-56D21B Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 x 1 vial 493 € genways human
GWB-64D2AA Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 tube 654 € genways human
GWB-84AFB7 Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 vial 602 € genways human
GWB-9FBEC8 Mouse antibody to or anti-Human CD79 (B29 Ig), antibody 1 vial 470 € genways human
GWB-ATG086 CD79B, 29-159aa, Human, His tag, E.coli , Recombinant Protein bulk Ask price € genways bulk human
abx260988 Anti-CD79B Protein (Recombinant) 5 µg 238 € abbex human
BMDV10270 CD79b, B-cell Antigen Receptor Ig b chain (BCR-Ig beta), 38kD, Clone: SN8, Mouse Monoclonal antibody-Human; frozen/NO paraffin, IH/flow 500ul 591 € accurate-monoclonals human
AXL7259M CD79b, B-Cell, Clone: SN8, Mouse Monoclonal antibody-Human 1000ul 1280 € accurate-monoclonals human
AXL7260F CD79b, B-Cell, Clone: SN8, Mouse Monoclonal antibody-Human, FITC 1000ul 1899 € accurate-monoclonals human
YM1093 CD79b, B-Cell Receptor ß-chain, Iga/Igß hetrodimer, Clone: 29T-04, Mouse Monoclonal antibody-Human 1000ul Ask price € accurate-monoclonals human
MEDCLA013 CD79b, Clone: JS01, Mouse Monoclonal antibody-Human; paraffin, IHC 1000ul 1392 € accurate-monoclonals human
LV112420 CD79B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV112421 CD79B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human