Recombinant Human Follitropin Subunit β, FSHB (C-6His)

Contact us
Catalog number: CA13
Price: 1895 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Follitropin Subunit β, FSHB (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FSHB is produced by our Mammalian expression system and the target gene encoding Asn19-Glu129 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13, 5 kD
UniProt number: P01225
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FSHB (C-6His), Follitropin Subunit &beta
Short name: FSHB (C-6His), Recombinant Follitropin Subunit &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b polypeptide (C-6His), follicle stimulating hormone, sapiens Follitropin functionnal sequence &beta, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, FSHB and IDBG-37119 and ENSG00000131808 and 2488, Fshb and IDBG-195409 and ENSMUSG00000027120 and 14308, beta polypeptide, protein binding, this GO :0001541 and ovarian follicle development and biological process this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006701 and progesterone biosynthetic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007292 and female gamete generation and biological process this GO :0007565 and female pregnancy and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0016486 and peptide hormone processing and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0042699 and follicle-stimulating hormone signaling pathway and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045780 and positive regulation of bone resorption and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0060011 and Sertoli cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, follicle stimulating hormone
Identity: 3964
Gene: FSHB | More about : FSHB
Long gene name: follicle stimulating hormone beta subunit
Synonyms gene name: beta polypeptide , follicle stimulating hormone
Synonyms name: beta chain , follitropin
Locus: 11p14, 1
Discovery year: 1986-01-01
Entrez gene record: 2488
Pubmed identfication: 2885163 3151250
RefSeq identity: NM_000510
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000166146

Related Products :

CA13 Recombinant Human Follitropin Subunit β, FSHB (C-6His) 1 mg 2283 € novo human
AE43144BO Bovine Follitropin subunit beta (FSHB) ELISA Kit 48 wells plate 500 € ab-elisa elisas bovine
AE43144BO-96 Bovine Follitropin subunit beta (FSHB) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE43144BO-48 ELISA test for Bovine Follitropin subunit beta (FSHB) 1x plate of 48 wells 402 € abebio bovine
AE43142GU-48 ELISA test for Guinea pig Follitropin subunit beta (FSHB) 1x plate of 48 wells 402 € abebio human
AE58712HO-48 ELISA test for Horse Follitropin subunit beta (FSHB) 1x plate of 48 wells 402 € abebio horse
AE43139PI-48 ELISA test for Pig Follitropin subunit beta (FSHB) 1x plate of 48 wells 402 € abebio pig
AE43142GU Guinea pig Follitropin subunit beta (FSHB) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE43142GU-96 Guinea pig Follitropin subunit beta (FSHB) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE58712HO-96 Horse Follitropin subunit beta (FSHB) ELISA Kit 1x plate of 96 wells 671 € abebio horse
AE43139PI-96 Pig Follitropin subunit beta (FSHB) ELISA Kit 1x plate of 96 wells 671 € abebio pig
GENTAUR-58bcbdbee00de Pongo pygmaeus Follitropin subunit beta (FSHB) 100ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bcbdbf2400a Pongo pygmaeus Follitropin subunit beta (FSHB) 1000ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bcbdc071a01 Pongo pygmaeus Follitropin subunit beta (FSHB) 100ug 1895 € MBS Recombinant Proteins human
GENTAUR-58bcbdc0d0742 Pongo pygmaeus Follitropin subunit beta (FSHB) 1000ug 1895 € MBS Recombinant Proteins human
GENTAUR-58bb7017b82a5 Rat Follitropin subunit beta (Fshb) 100ug 1393 € MBS Recombinant Proteins rat
GENTAUR-58bb701812bf2 Rat Follitropin subunit beta (Fshb) 1000ug 1393 € MBS Recombinant Proteins rat
GENTAUR-58bb70184c4e9 Rat Follitropin subunit beta (Fshb) 100ug 1895 € MBS Recombinant Proteins rat
GENTAUR-58bb7018969ea Rat Follitropin subunit beta (Fshb) 1000ug 1895 € MBS Recombinant Proteins rat
GENTAUR-58b38255813b2 Struthio camelus Follitropin subunit beta (FSHB) 100ug 1382 € MBS Recombinant Proteins human
GENTAUR-58b38255afae2 Struthio camelus Follitropin subunit beta (FSHB) 1000ug 1382 € MBS Recombinant Proteins human
GENTAUR-58b38255ee01c Struthio camelus Follitropin subunit beta (FSHB) 100ug 1884 € MBS Recombinant Proteins human
GENTAUR-58b3825627c0b Struthio camelus Follitropin subunit beta (FSHB) 1000ug 1884 € MBS Recombinant Proteins human
GENTAUR-58b43bac6a8c1 Struthio camelus Follitropin subunit beta (FSHB) 100ug 1382 € MBS Recombinant Proteins human
GENTAUR-58b43bacd1d6c Struthio camelus Follitropin subunit beta (FSHB) 1000ug 1382 € MBS Recombinant Proteins human
GENTAUR-58b43bad2eb00 Struthio camelus Follitropin subunit beta (FSHB) 100ug 1884 € MBS Recombinant Proteins human
GENTAUR-58b43bad9491c Struthio camelus Follitropin subunit beta (FSHB) 1000ug 1884 € MBS Recombinant Proteins human
GENTAUR-58bc4d6c297c9 Trichosurus vulpecula Follitropin subunit beta (FSHB) 100ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bc4d6c5f961 Trichosurus vulpecula Follitropin subunit beta (FSHB) 1000ug 1393 € MBS Recombinant Proteins human
GENTAUR-58bc4d6cb021f Trichosurus vulpecula Follitropin subunit beta (FSHB) 100ug 1895 € MBS Recombinant Proteins human