| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FSHB is produced by our Mammalian expression system and the target gene encoding Asn19-Glu129 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13, 5 kD |
| UniProt number: |
P01225 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FSHB (C-6His), Follitropin Subunit &beta |
| Short name: |
FSHB (C-6His), Recombinant Follitropin Subunit &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
b polypeptide (C-6His), follicle stimulating hormone, sapiens Follitropin functionnal sequence &beta, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FSHB and IDBG-37119 and ENSG00000131808 and 2488, Fshb and IDBG-195409 and ENSMUSG00000027120 and 14308, beta polypeptide, protein binding, this GO :0001541 and ovarian follicle development and biological process this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006701 and progesterone biosynthetic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007292 and female gamete generation and biological process this GO :0007565 and female pregnancy and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0016486 and peptide hormone processing and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0042699 and follicle-stimulating hormone signaling pathway and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045780 and positive regulation of bone resorption and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0060011 and Sertoli cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, follicle stimulating hormone |
| Identity: |
3964 |
| Gene: |
FSHB |
More about : FSHB |
| Long gene name: |
follicle stimulating hormone beta subunit |
| Synonyms gene name: |
beta polypeptide , follicle stimulating hormone |
| Synonyms name: |
beta chain , follitropin |
| Locus: |
11p14, 1 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
2488 |
| Pubmed identfication: |
2885163 3151250 |
| RefSeq identity: |
NM_000510 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000166146 |