Recombinant Human Vitamin D-Binding Protein, VDB, Gc-globulin (C-6His)

Contact us
Catalog number: C953
Price: 1041 €
Supplier: genways
Product name: Recombinant Human Vitamin D-Binding Protein, VDB, Gc-globulin (C-6His)
Quantity: 1 vial
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vitamin D-Binding Protein is produced by our Mammalian expression system and the target gene encoding Leu17-Leu474 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 52
UniProt number: P02774
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Gc-globulin (C-6His), VDB, Vitamin D-Binding Protein
Short name: Gc-globulin (C-6His), VDB, Recombinant Vitamin D-Binding Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Gc-globulin (C-6His), VDB, sapiens Vitamin D-Binding Protein, recombinant H
Alternative technique: rec

Related Products :

C953 Recombinant Human Vitamin D-Binding Protein, VDB, Gc-globulin (C-6His) 500 µg 1613 € novo human
CGC-80A anti-Human Gc Globulin (Vitamin D Binding Protein) Host: Chicken Unconjugated A.P. 1.0 mg 409 € icl chicken
CGC-80A-Z anti-Human Gc Globulin (Vitamin D Binding Protein) Host: Chicken Unconjugated A.P. 0.1 mg 136 € icl chicken
HYB249-01 Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-01, Mouse Monoclonal antibody-Human; ELISA/WB 0.2mg 1623 € accurate-monoclonals human
HYB249-01B Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-01, Mouse Monoclonal antibody-Human; ELISA/WB, Biotin 50 ug 1338 € accurate-monoclonals human
HYB249-02 Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-02, Mouse Monoclonal antibody-Human; ELISA/WB 0.2mg 1623 € accurate-monoclonals human
HYB249-02B Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-02, Mouse Monoclonal antibody-Human; ELISA/WB, Biotin 50 ug 1338 € accurate-monoclonals human
HYB249-05 Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-05, Mouse Monoclonal antibody-Human; ELISA 0.2mg 1623 € accurate-monoclonals human
HYB249-10 Gc-Globulin, Vitamin D-Binding Protein, Clone: 249-10, Mouse Monoclonal antibody-Human; ELISA/WB 0.2mg 1623 € accurate-monoclonals human
GWB-R3VDBP Rat Vitamin D Binding protein (GC Globulin) 96 well plate ELISA assay 1 96 well plate ELISA plate 634 € genways rat
CA78 Recombinant Human Vitamin K-Dependent Protein C, PROC (C-6His) 1 mg 2283 € novo human
GENTAUR-58be21e624162 Biotin (Vitamin B7 or Vitamin H) 100ug 354 € MBS mono human
GENTAUR-58be2312d8ade Biotin (Vitamin B7 or Vitamin H) 100ug 354 € MBS mono human
GENTAUR-58be21e5b8e7c Biotin (Vitamin B7 or Vitamin H) Antibody 100ug 354 € MBS mono human
GENTAUR-58be231290621 Biotin (Vitamin B7 or Vitamin H) Antibody 100ug 354 € MBS mono human
abx166638 Anti-Corticosteroid Binding Globulin (CBG) Protein (Recombinant) 10 μg 398 € abbex human
abx166639 Anti-Corticosteroid Binding Globulin (CBG) Protein (Recombinant) 100 μg 833 € abbex human
abx168373 Anti-Thyroxine Binding Globulin Protein (Recombinant) 50 μg 615 € abbex human
SHBG11-C Purified human serum Sex hormone-binding globulin (SHBG/SSBG) protein control for western 100 μL 333 € adi human
MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
abx165981 Anti-Vitamin D Binding Protein (Recombinant) 10 μg 412 € abbex human
abx165984 Anti-Vitamin D Binding Protein (Recombinant) 100 μg 847 € abbex human
abx150969 Anti-Human Corticosteroid Binding Globulin (CBG) ELISA Kit inquire 50 € abbex human
abx253715 Anti-Human Corticosteroid Binding Globulin (CBG) ELISA Kit 96 tests 659 € abbex human
MBS573049 Anti-Human cortisol binding globulin Antibody 1 mililiter 337 € MBS Polyclonals_1 human
MBS222707 Anti-HUMAN THYROXINE BINDING GLOBULIN 1000 Tests 514 € MBS Polyclonals_1 human
abx190095 Anti-Human Thyroxine Binding Globulin CLIA Kit inquire 50 € abbex human
abx253790 Anti-Human Thyroxine-binding globulin ELISA Kit inquire 50 € abbex human
abx573445 Anti-Human Thyroxine Binding Globulin (TBG) ELISA Kit inquire 50 € abbex human
GWB-E1988F antibody to or anti- Sex Hormone Binding Globulin (SHBG) human antibody 1 vial 1041 € genways human