Recombinant Human CEACAM7, CGM2 (C-6His)

Contact us
Catalog number: C926
Price: 1613 €
Supplier: novo
Product name: Recombinant Human CEACAM7, CGM2 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CEACAM7 is produced by our Mammalian expression system and the target gene encoding Thr36-Phe142 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 13
UniProt number: Q14002
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CGM2 (C-6His), CEACAM7
Short name: CGM2 (C-6His), Recombinant CEACAM7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CGM2 (C-6His), sapiens carcinoembryonic antigen-related cellular adhesion molecule 7, recombinant H
Alternative technique: rec
Alternative to gene target: CEA and CGM2, CEACAM7 and IDBG-53139 and ENSG00000007306 and 1087, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031225 and anchored component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, carcinoembryonic antigen-related cell adhesion molecule 7
Identity: 1819
Gene: CEACAM7 | More about : CEACAM7
Long gene name: carcinoembryonic antigen related cell adhesion molecule 7
Synonyms gene: CGM2
Synonyms gene name: carcinoembryonic antigen-related cell adhesion molecule 7
Synonyms: CEA
Synonyms name: carcinoembryonic antigen gene family member 2
Locus: 19q13, 2
Discovery year: 1991-09-12
GenBank acession: X98311
Entrez gene record: 1087
Pubmed identfication: 7806520 9135022
RefSeq identity: NM_006890
Classification: Immunoglobulin like domain containing V-set domain containing Carcinoembryonic antigen related cell adhesion molecule family
Havana BLAST/BLAT: OTTHUMG00000151063

Related Products :

C926 Recombinant Human CEACAM7, CGM2 (C-6His) 1 mg 2283 € novo human
MBS611003 Carcinoembryonic Antigen CGM2 (CEACGM2) Antibody 50ug 625 € MBS Polyclonals_1 human
GWB-ATG253 CEACAM7, 36-242aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
abx151025 Anti-Human CEACAM7 ELISA Kit inquire 50 € abbex human
abx570669 Anti-Human CEACAM7 ELISA Kit inquire 50 € abbex human
GENTAUR-58be23dd7075f anti-human CEACAM7 monoclonal antibody 100ug 547 € MBS mono human
LV115513 CEACAM7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV115514 CEACAM7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV115515 CEACAM7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV115516 CEACAM7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV115518 CEACAM7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV115517 CEACAM7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
DL-CEACAM7-Hu Human Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 CEACAM7 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdcc8c14781 Anti- Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdce37b68bd Anti- Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdce38306aa Anti- Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdda842ee02 Anti- Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) Antibody 100ug 564 € MBS Polyclonals human
AR50949PU-N anti-CEACAM7 (36-242, His-tag) Antibody 0,25 mg 1413 € acr human
AR50949PU-S anti-CEACAM7 (36-242, His-tag) Antibody 50 Вµg 587 € acr human
DM1207 anti-CEACAM7 Antibody 0,1 mg 572 € acr human
XW-8102 anti-CEACAM7 Antibody 0.05 mg 180 € proscience human
abx149191 Anti-CEACAM7 Antibody 100 μg 311 € abbex human
abx225103 Anti-CEACAM7 Antibody 100 μl 383 € abbex human
abx911391 Anti-CEACAM7 siRNA 30 nmol 717 € abbex human
EKU02949 Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-MV853G CEACAM7 antibody 1 vial 521 € genways human
GWB-MV854H CEACAM7 antibody 1 vial 521 € genways human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human