Recombinant Human cGMP-Dependent Protein Kinase 1, PRKG1 (C-6His)

Contact us
Catalog number: C923
Price: 717 €
Supplier: abbex
Product name: Recombinant Human cGMP-Dependent Protein Kinase 1, PRKG1 (C-6His)
Quantity: 30 nmol
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human cGMP-Dependent Protein Kinase 1 is produced by our Mammalian expression system and the target gene encoding Gly2-Pro686 is expressed with a 6His tag at the C-terminus
Molecular Weight: 78, 8 kD
UniProt number: Q13976-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRKG1 (C-6His), cGMP-Dependent Protein Kinase 1
Short name: PRKG1 (C-6His), Recombinant cGMP-Dependent Protein Kinase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PRKG1 (C-6His), sapiens cGMP-Dependent Protein phosphorylation catalyst 1, recombinant H
Alternative technique: rec
Identity: 9414
Gene: PRKG1 | More about : PRKG1
Long gene name: cGMP-dependent, protein kinase, type I
Synonyms gene: PRKGR1B PRKG1B
Synonyms: PGK PKG
Locus: 10q11, 1 , 23-q21
Discovery year: 1991-07-17
Entrez gene record: 5592
Pubmed identfication: 2792381 1544322
Havana BLAST/BLAT: OTTHUMG00000018248

Related Products :

MBS613170 cGMP Binding cGMP-Specific Phosphodiesterase V (PDE5, PDE5A, CN5A, PDE5,CGB-PDE, phosphodiesterase 5A, cGMP-specific, cGMP-binding cGMP-specific 3', 5'-cyclic nucleotide phosphodiesterase) 100ug 735 € MBS Polyclonals_1 human
MBS624592 PRKG1, CT (cGMP-dependent Protein Kinase 1, cGK 1, cGK1, cGMP-dependent Protein Kinase I, cGKI, PRKG1B, PRKGR1A, PRKGR1B) 200ul 603 € MBS Polyclonals_1 human
MBS610180 Phosphodiesterase 5A (Phosphodiesterase 5A cGMP-specific, PDE5A, PDE-5A, PDE5A1, cGMP Binding cGMP Specific 3' 5' Cyclic Nucleotide Phosphodiesterase, cGMP-binding cGMP-specific 3' 5'-cyclic Nucleotide Phosphodiesterase, cGMP Binding cGMP Specific Phospho 100ug 785 € MBS Polyclonals_1 human
C923 Recombinant Human cGMP-Dependent Protein Kinase 1, PRKG1 (C-6His) 10 µg 202 € novo human
DL-PRKG1-Hu Human Protein Kinase, cGMP Dependent Type I PRKG1 ELISA Kit 96T 904 € DL elisas human
E-EL-Ch0182 Chicken PRKG1 (Protein Kinase, cGMP Dependent Type I) ELISA Kit 96T 568 € elabsciences chicken
DL-PRKG1-Mu Mouse Protein Kinase, cGMP Dependent Type I PRKG1 ELISA Kit 96T 921 € DL elisas mouse
EKU06932 Protein Kinase, cGMP Dependent Type I (PRKG1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU06933 Protein Kinase, cGMP Dependent Type I (PRKG1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
GENTAUR-58bcf397a19fc Dictyostelium discoideum cGMP-specific 3',5'-cGMP phosphodiesterase 3 (pde3) 100ug 2299 € MBS Recombinant Proteins human
GENTAUR-58bcf397ee9ae Dictyostelium discoideum cGMP-specific 3',5'-cGMP phosphodiesterase 3 (pde3) 1000ug 2299 € MBS Recombinant Proteins human
GENTAUR-58bcf3983338d Dictyostelium discoideum cGMP-specific 3',5'-cGMP phosphodiesterase 3 (pde3) 100ug 2813 € MBS Recombinant Proteins human
GENTAUR-58bcf398796ab Dictyostelium discoideum cGMP-specific 3',5'-cGMP phosphodiesterase 3 (pde3) 1000ug 2813 € MBS Recombinant Proteins human
MBS612089 Phosphodiesterase 6 gamma (Phosphodiesterase 6G cGMP Specific, PDE6 gamma, PDE6g, PDEG, Retinal Rod Photoreceptor cGMP Phosphodiesterase gamma) Antibody 100ul 735 € MBS Polyclonals_1 human
abx152824 Anti-Human PRKG1 ELISA Kit inquire 50 € abbex human
abx571127 Anti-Human PRKG1 ELISA Kit 96 tests 789 € abbex human
GENTAUR-58bde736f14c7 Mouse Monoclonal [clone 2B3] (IgG1,k) to Human PKG / PRKG1 Antibody 50ug 663 € MBS mono human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human
abx253042 Anti-Human Protein Kinase, cGMP Dependent Type I ELISA Kit inquire 50 € abbex human
abx156783 Anti-Human Protein Kinase, cGMP Dependent Type II ELISA Kit 96 tests 934 € abbex human
abx154575 Anti-Mouse PRKG1 ELISA Kit inquire 50 € abbex mouse
abx571903 Anti-Mouse PRKG1 ELISA Kit inquire 50 € abbex mouse
GENTAUR-58be0b1881264 Anti- PRKG1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0b18d3630 Anti- PRKG1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3db9525c8 Anti- PRKG1 Antibody 100ug 393 € MBS Polyclonals human
abx142173 Anti-PRKG1 Antibody 100 μl 383 € abbex human
abx147517 Anti-PRKG1 Antibody inquire 50 € abbex human
abx147626 Anti-PRKG1 Antibody 100 μg 311 € abbex human
abx929789 Anti-PRKG1 siRNA 30 nmol 717 € abbex human